CD38 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB4TMF1YH31ZVM2EF12HCT2I652I662I672O3Q2O3R2O3S2O3T2O3U2PGJ2PGL3DZF3DZG3DZH3DZI3DZJ3DZK3F6Y3I9M3I9N3OFS3RAJ3ROK3ROM3ROP3ROQ3U4H3U4I4CMH4F454F464OGW4XJS4XJT5F1K5F1O5F21CD381072701074741345CD382.4.99.20transferase activityhydrolase activity, acting on glycosyl bondsNAD(P)+ nucleosidase activityhydrolase activityNAD+ nucleotidase, cyclic ADP-ribose generatingNAD+ nucleosidase activityphosphorus-oxygen lyase activityidentical protein bindingintegral component of membraneмембранавнутрішньоклітинна мембранна органелаcell surfaceextracellular exosomeклітинне ядроЦитоплазматична мембранаbasolateral plasma membranesecretory granule membraneB cell receptor signaling pathwayresponse to cytokineresponse to estradiolresponse to interleukin-1response to hypoxiaresponse to retinoic acidpositive regulation of cytosolic calcium ion concentrationresponse to progesteronefemale pregnancynegative regulation of apoptotic processresponse to hydroperoxidepositive regulation of transcription, DNA-templatedpositive regulation of cell growthpositive regulation of B cell proliferationpositive regulation of vasoconstrictionlong term synaptic depressionapoptotic signaling pathwayresponse to hormonenegative regulation of transcription, DNA-templatedresponse to drugСигнальна трансдукціяpositive regulation of insulin secretionnegative regulation of bone resorptionNAD metabolic processpositive regulation of cell proliferationnegative regulation of neuron projection developmentartery smooth muscle contractionAmigoQuickGOБільше даних95212494ENSG00000004468ENSMUSG00000029084P28907P56528NM_001775NM_007646NP_001766NP_031672Хр. 4: 15.78 – 15.85 MbХр. 5: 43.87 – 43.91 MbPubMed10.1101/gr.2596504PubMed10.1016/0968-0004(92)90337-9PubMed10.1186/gb-2004-5-2-r8PubMed10.1016/j.bbrc.2006.04.096PubMedHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:1667UniProt, P28907виправивши або дописавши їїпідказкою

Гени на хромосомі 4Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофантрансферазгідролазрецепторівальтернативний сплайсингНАДФ






































CD38
Protein CD38 PDB 1yh3.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

CD38, ADPRC1, ADPRC 1, CD38 molecule
Зовнішні ІД
OMIM: 107270 MGI: 107474 HomoloGene: 1345 GeneCards: CD38
шифр КФ
2.4.99.20








Шаблон експресії
PBB GE CD38 205692 s at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001775


NM_007646
RefSeq (білок)

NP_001766

NP_031672
Локус (UCSC)
Хр. 4: 15.78 – 15.85 Mb

Хр. 5: 43.87 – 43.91 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

CD38 (англ. CD38 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 300 амінокислот, а молекулярна маса — 34 328[4].



Послідовність амінокислот

































































1020304050
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQW
SGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCN
ITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLL
GYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA
CDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS
RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до трансфераз, гідролаз, рецепторів.
Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг.
Білок має сайт для зв'язування з НАД, НАДФ.
Локалізований у мембрані.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • States D.J., Walseth T.F., Lee H.C. (1992). Similarities in amino acid sequences of Aplysia ADP-ribosyl cyclase and human lymphocyte antigen CD38.. Trends Biochem. Sci. 17: 495 — 495.  PubMed DOI:10.1016/0968-0004(92)90337-9


  • Hillman R.T., Green R.E., Brenner S.E. (2004). An unappreciated role for RNA surveillance.. Genome Biol. 5: R8.1 — R8.16.  PubMed DOI:10.1186/gb-2004-5-2-r8


  • Moreschi I., Bruzzone S., Melone L., De Flora A., Zocchi E. (2006). NAADP+ synthesis from cADPRP and nicotinic acid by ADP-ribosyl cyclases.. Biochem. Biophys. Res. Commun. 345: 573 — 580.  PubMed DOI:10.1016/j.bbrc.2006.04.096


  • Jackson D.G., Bell J.I. (1990). Isolation of a cDNA encoding the human CD38 (T10) molecule, a cell surface glycoprotein with an unusual discontinuous pattern of expression during lymphocyte differentiation.. J. Immunol. 144: 2811 — 2815.  PubMed



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:1667 (англ.). Процитовано 30 серпня 2017. 


  4. UniProt, P28907 (англ.). Процитовано 30 серпня 2017. 



Див. також |


  • Хромосома 4





Popular posts from this blog

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?