NKX2-1 Література | Примітки | Див. також | Навігаційне менюNKX2-11080672488NKX2-1DNA bindingsequence-specific DNA bindingintronic transcription regulatory region DNA bindingprotein bindingenzyme bindingRNA polymerase II regulatory region DNA bindingRNA polymerase II regulatory region sequence-specific DNA bindingcore promoter bindingintronic transcription regulatory region sequence-specific DNA bindingtranscription factor activity, sequence-specific DNA bindingtranscription factor activity, RNA polymerase II distal enhancer sequence-specific bindingtranscription regulatory region DNA bindingRNA polymerase II transcription factor activity, sequence-specific DNA bindingRNA polymerase II core promoter proximal region sequence-specific DNA bindingRNA polymerase II distal enhancer sequence-specific DNA bindingnucleoplasmклітинне ядроtranscription factor complexregulation of transcription, DNA-templatedритмічний процесnegative regulation of transforming growth factor beta receptor signaling pathwaytranscription, DNA-templatedpositive regulation of gene expressionnegative regulation of cell migrationresponse to hormoneforebrain developmentepithelial tube branching involved in lung morphogenesisnegative regulation of epithelial to mesenchymal transitionnegative regulation of transcription from RNA polymerase II promoterneuron migrationregulation of transcription from RNA polymerase II promoterphospholipid metabolic processpattern specification processaxon guidancebrain developmentendoderm developmentlocomotory behavioranimal organ morphogenesistelencephalon developmentglobus pallidus developmenthippocampus developmentcerebral cortex cell migrationforebrain dorsal/ventral pattern formationforebrain neuron fate commitmentforebrain neuron differentiationcerebral cortex GABAergic interneuron differentiationcerebral cortex neuron differentiationpituitary gland developmenttelencephalon cell migrationlung developmentthyroid gland developmentdevelopmental inductionLeydig cell differentiationpositive regulation of circadian rhythmnegative regulation of transcription, DNA-templatedpositive regulation of transcription, DNA-templatedpositive regulation of transcription from RNA polymerase II promoteranatomical structure formation involved in morphogenesisneuron fate commitmentoligodendrocyte differentiationlung saccule developmentClara cell differentiationType II pneumocyte differentiationДиференціація клітинAmigoQuickGOБільше даних708021869ENSG00000136352ENSMUSG00000001496P43699P50220NM_001079668NM_003317NM_001146198NM_009385NP_001073136NP_003308NP_001139670NP_033411Хр. 14: 36.52 – 36.52 MbХр. 12: 56.53 – 56.54 MbPubMed10.1016/0167-4781(95)00033-DPubMed10.1016/0167-4781(95)00034-EPubMed10.1101/gr.2596504PubMed10.1016/j.jpeds.2004.04.011PubMed10.1177/0883073813518243Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:11825UniProt, P43699виправивши або дописавши її

Гени на хромосомі 14Hox-гени


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанрепресорівактиваторівфосфопротеїнівтранскрипціятранскрипціїальтернативний сплайсингДНКядрі




































NKX2-1
Protein TITF1 PDB 1ftt.png
Ідентифікатори

Символи

NKX2-1, Nkx2-1, AV026640, Nkx2.1, T/EBP, Titf1, Ttf-1, BCH, BHC, NK-2, NKX2A, TEBP, TTF1, NMTC1, NK2 homeobox 1
Зовнішні ІД
MGI: 108067 HomoloGene: 2488 GeneCards: NKX2-1








Шаблон експресії

PBB GE TITF1 210673 x at fs.png

PBB GE TITF1 211024 s at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001079668
NM_003317



NM_001146198
NM_009385

RefSeq (білок)

NP_001073136
NP_003308


NP_001139670
NP_033411

Локус (UCSC)
Хр. 14: 36.52 – 36.52 Mb

Хр. 12: 56.53 – 56.54 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

NKX2-1 (англ. NK2 homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 371 амінокислот, а молекулярна маса — 38 596[4].



Послідовність амінокислот















































































1020304050
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPT
AAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY
QDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS
KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHL
TPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQA
QQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA
AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL
NSSGSDYGTMSCSTLLYGRTW

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів.
Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг.
Білок має сайт для зв'язування з ДНК.
Локалізований у ядрі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Oguchi H., Pan Y.-T., Kimura S. (1995). The complete nucleotide sequence of the mouse thyroid-specific enhancer-binding protein (T/EBP) gene: extensive identity of the deduced amino acid sequence with the human protein.. Biochim. Biophys. Acta 1261: 304 — 306.  PubMed DOI:10.1016/0167-4781(95)00033-D


  • Saiardi A., Tassi V., de Filippis V., Civitareale D. (1995). Cloning and sequence analysis of human thyroid transcription factor 1.. Biochim. Biophys. Acta 1261: 307 — 310.  PubMed DOI:10.1016/0167-4781(95)00034-E


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Doyle D.A., Gonzalez I., Thomas B., Scavina M. (2004). Autosomal dominant transmission of congenital hypothyroidism, neonatal respiratory distress, and ataxia caused by a mutation of NKX2-1.. J. Pediatr. 145: 190 — 193.  PubMed DOI:10.1016/j.jpeds.2004.04.011


  • Williamson S., Kirkpatrick M., Greene S., Goudie D. (2014). A novel mutation of NKX2-1 affecting 2 generations with hypothyroidism and choreoathetosis: part of the spectrum of brain-thyroid-lung syndrome.. J. Child Neurol. 29: 666 — 669.  PubMed DOI:10.1177/0883073813518243



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:11825 (англ.). Процитовано 11 вересня 2017. 


  4. UniProt, P43699 (англ.). Процитовано 11 вересня 2017. 



Див. також |


  • Хромосома 14



Popular posts from this blog

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?

Тонконіг бульбистий Зміст Опис | Поширення | Екологія | Господарське значення | Примітки | Див. також | Література | Джерела | Посилання | Навігаційне меню1114601320038-241116202404kew-435458Poa bulbosaЭлектронный каталог сосудистых растений Азиатской России [Електронний каталог судинних рослин Азіатської Росії]Малышев Л. Л. Дикие родичи культурных растений. Poa bulbosa L. - Мятлик луковичный. [Малишев Л. Л. Дикі родичи культурних рослин. Poa bulbosa L. - Тонконіг бульбистий.]Мятлик (POA) Сем. Злаки (Мятликовые) [Тонконіг (POA) Род. Злаки (Тонконогові)]Poa bulbosa Linnaeus, Sp. Pl. 1: 70. 1753. 鳞茎早熟禾 lin jing zao shu he (Description from Flora of China) [Poa bulbosa Linnaeus, Sp. Pl. 1: 70. 1753. 鳞茎早熟禾 lin jing zao shu he (Опис від Флора Китаю)]Poa bulbosa L. – lipnice cibulkatá / lipnica cibulkatáPoa bulbosa в базі даних Poa bulbosa на сайті Poa bulbosa в базі даних «Global Biodiversity Information Facility» (GBIF)Poa bulbosa в базі даних «Euro + Med PlantBase» — інформаційному ресурсі для Євро-середземноморського розмаїття рослинPoa bulbosa L. на сайті «Плантариум»

If a poisoned arrow's piercing damage is reduced to 0, do you still get poisoned? The 2019 Stack Overflow Developer Survey Results Are InDoes a zero-damage attack still count as a hit?Damage reduction and damage resistance: how to calculate?If a monk reduces damage to 0 using Deflect Missiles, does the attack still hit?Do damage resistance and temp hit points from False Life and the Heavy Armor Master feat stack?When does Armor of Agathys take effect?Should the damage from an unarmed strike be reduced by Heavy Armor Master?What's the duration of these wild feats?Does the Heavy Armor Master feat reduce damage twice against a mixed damage attack?Are Erinyes' Hellish Weapons poisonous in a PC's hands?How can I gain resistance to piercing, bludgeoning, and slashing damage while in heavy armor?Damage reduction and damage resistance: how to calculate?Can Mage Hand Legerdemain load a hand crossbow? What about two hand crossbows?Does the Polearm Master attack work with poison?