PIK3AP1 Література | Примітки | Див. також | Навігаційне менюPIK3AP1193317712848PIK3AP1phosphatidylinositol 3-kinase regulatory subunit bindingidentical protein bindingphosphatidylinositol-4,5-bisphosphate 3-kinase activityЦитоплазмаГіалоплазмаЦитоплазматична мембранамембранаpositive regulation of phosphatidylinositol 3-kinase signalingtoll-like receptor 9 signaling pathwaytoll-like receptor 2 signaling pathwaytoll-like receptor 4 signaling pathwaytoll-like receptor 7 signaling pathwayregulation of inflammatory responsephosphatidylinositol phosphorylationpositive regulation of protein kinase B signalingAmigoQuickGO11878883490ENSG00000155629ENSMUSG00000025017Q6ZUJ8Q9EQ32NM_152309NM_031376NP_689522NP_113553Хр. 10: 96.59 – 96.72 MbХр. 19: 41.27 – 41.39 MbPubMed10.1101/gr.2596504Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:30034UniProt, Q6ZUJ8виправивши або дописавши їїпідказкою

Гени на хромосомі 10Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанфосфопротеїнівальтернативний сплайсингклітинній мембраніцитоплазмі


































PIK3AP1
Ідентифікатори

Символи

PIK3AP1, BCAP, phosphoinositide-3-kinase adaptor protein 1
Зовнішні ІД
MGI: 1933177 HomoloGene: 12848 GeneCards: PIK3AP1








Ортологи
ВидиЛюдинаМиша
Entrez

118788


83490
Ensembl

ENSG00000155629


ENSMUSG00000025017
UniProt

Q6ZUJ8


Q9EQ32
RefSeq (мРНК)

NM_152309


NM_031376
RefSeq (білок)

NP_689522

NP_113553
Локус (UCSC)
Хр. 10: 96.59 – 96.72 Mb

Хр. 19: 41.27 – 41.39 Mb

PubMed search
[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

PIK3AP1 (англ. Phosphoinositide-3-kinase adaptor protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 805 амінокислот, а молекулярна маса — 90 398[4].



Послідовність амінокислот



























































































































































1020304050
MAASGVPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPE
ASFSAEDLSLFLSTRCVVVLLSAELVQHFHKPALLPLLQRAFHPPHRVVR
LLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKKAISEDSGCDSV
TDTEPEDEKVVSYSKQQNLPTVTSPGNLMVVQPDRIRCGAETTVYVIVRC
KLDDRVATEAEFSPEDSPSVRMEAKVENEYTISVKAPNLSSGNVSLKIYS
GDLVVCETVISYYTDMEEIGNLLSNAANPVEFMCQAFKIVPYNTETLDKL
LTESLKNNIPASGLHLFGINQLEEEDMMTNQRDEELPTLLHFAAKYGLKN
LTALLLTCPGALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDM
LKSHIKEELMHGEEADAVYESMAHLSTDLLMKCSLNPGCDEDLYESMAAF
VPAATEDLYVEMLQASTSNPIPGDGFSRATKDSMIRKFLEGNSMGMTNLE
RDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDN
EPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGM
KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENL
KRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRK
SVIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNE
VPEVTRSRSPGPPQVDGTPTMSLERPPRVPPRAASQRPPTRETFHPPPPV
PPRGR

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функцією належить до фосфопротеїнів.
Задіяний у такому біологічному процесі, як альтернативний сплайсинг.
Локалізований у клітинній мембрані, цитоплазмі, мембрані.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


Примітки |




  1. ↑ Human PubMed Reference:. 


  2. ↑ Mouse PubMed Reference:. 


  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:30034 (англ.). Процитовано 8 вересня 2017. 


  4. ↑ UniProt, Q6ZUJ8 (англ.). Процитовано 8 вересня 2017. 



Див. також |


  • Хромосома 10



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.


Wiki letter w.svg

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка, скористайтеся підказкою та розставте посилання відповідно до прийнятих рекомендацій.


-

Popular posts from this blog

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?

Image
What to do when during a meeting client people start to fight (even physically) with each others? How to pass a string to a command that expects a file? How could our ancestors have domesticated a solitary predator? Solving "Resistance between two nodes on a grid" problem in Mathematica Why would one plane in this picture not have gear down yet? My story is written in English, but is set in my home country. What language should I use for the dialogue? Do items de-spawn in Diablo? Why doesn't this Google Translate ad use the word "Translation" instead of "Translate"? How do I express some one as a black person? Subset counting for even numbers Is there a window switcher for GNOME that shows the actual window? Are babies of evil humanoid species inherently evil? Could you please stop shuffling the deck and play already? Are the terms "stab" and "staccato" synonyms? What is the chance of making a successful ...
Read more

Тонконіг бульбистий Зміст Опис | Поширення | Екологія | Господарське значення | Примітки | Див. також | Література | Джерела | Посилання | Навігаційне меню1114601320038-241116202404kew-435458Poa bulbosaЭлектронный каталог сосудистых растений Азиатской России [Електронний каталог судинних рослин Азіатської Росії]Малышев Л. Л. Дикие родичи культурных растений. Poa bulbosa L. - Мятлик луковичный. [Малишев Л. Л. Дикі родичи культурних рослин. Poa bulbosa L. - Тонконіг бульбистий.]Мятлик (POA) Сем. Злаки (Мятликовые) [Тонконіг (POA) Род. Злаки (Тонконогові)]Poa bulbosa Linnaeus, Sp. Pl. 1: 70. 1753. 鳞茎早熟禾 lin jing zao shu he (Description from Flora of China) [Poa bulbosa Linnaeus, Sp. Pl. 1: 70. 1753. 鳞茎早熟禾 lin jing zao shu he (Опис від Флора Китаю)]Poa bulbosa L. – lipnice cibulkatá / lipnica cibulkatáPoa bulbosa в базі даних Poa bulbosa на сайті Poa bulbosa в базі даних «Global Biodiversity Information Facility» (GBIF)Poa bulbosa в базі даних «Euro + Med PlantBase» — інформаційному ресурсі для Євро-середземноморського розмаїття рослинPoa bulbosa L. на сайті «Плантариум»

Image
ТонконігРослини, описані 1753Флора АзіїФлора ЄвропиФлора АфрикиКормові культуриГазонні трави Thuill.TzvelevWilh.Steud.Trin.FeinbrunAzn.Velen.BalansaRoshev.Ovcz.Heldr.Parl.H.ScholzH.ScholzBorbásF.W.SchmidtSchurSchurSchurLej.R.Br.багаторічна рослинаТонконоговихКормовадеко...
Read more

If a poisoned arrow's piercing damage is reduced to 0, do you still get poisoned? The 2019 Stack Overflow Developer Survey Results Are InDoes a zero-damage attack still count as a hit?Damage reduction and damage resistance: how to calculate?If a monk reduces damage to 0 using Deflect Missiles, does the attack still hit?Do damage resistance and temp hit points from False Life and the Heavy Armor Master feat stack?When does Armor of Agathys take effect?Should the damage from an unarmed strike be reduced by Heavy Armor Master?What's the duration of these wild feats?Does the Heavy Armor Master feat reduce damage twice against a mixed damage attack?Are Erinyes' Hellish Weapons poisonous in a PC's hands?How can I gain resistance to piercing, bludgeoning, and slashing damage while in heavy armor?Damage reduction and damage resistance: how to calculate?Can Mage Hand Legerdemain load a hand crossbow? What about two hand crossbows?Does the Polearm Master attack work with poison?

Image
The difference between dialogue marks What do hard-Brexiteers want with respect to the Irish border? Spanish for "widget" What could be the right powersource for 15 seconds lifespan disposable giant chainsaw? Which Sci-Fi work first showed weapon of galactic-scale mass destruction? aging parents with no investments Why is it "Tumoren" and not "Tumore"? Limit the amount of RAM Mathematica may access? What does Linus Torvalds mean when he says that Git "never ever" tracks a file? Is three citations per paragraph excessive for undergraduate research paper? I see my dog run Is domain driven design an anti-SQL pattern? What does "rabbited" mean/imply in this sentence? How was Skylab's orbit inclination chosen? Extreme, unacceptable situation and I can't attend work tomorrow morning On the insanity of kings as an argument against monarchy How to manage monthly salary Lethal sonic weapons Can distinc...
Read more