POLD4 Література | Примітки | Див. також | Навігаційне менюPOLD4191699510909POLD4protein bindingDNA-directed DNA polymerase activitydelta DNA polymerase complexnucleoplasmЯдерцемітохондріяГіалоплазмаклітинне ядроDNA-dependent DNA replicationnucleotide-excision repair, DNA gap fillingDNA synthesis involved in DNA repairtranslesion synthesistranscription-coupled nucleotide-excision repairnucleotide-excision repair, DNA incisiontelomere maintenanceDNA damage response, detection of DNA damagenucleotide-excision repair, DNA incision, 5'-to lesionРепарація ДНКcellular response to DNA damage stimulustelomere maintenance via semi-conservative replicationРеплікація ДНКmismatch repairAmigoQuickGO5780469745ENSG00000175482Q9HCU8Q9CWP8NM_001256870NM_021173NM_027196NP_001243799NP_066996NP_081472Хр. 11: 67.35 – 67.36 MbPubMed10.1074/jbc.M001217200PubMed10.1101/gr.2596504PubMed10.1074/jbc.M208694200PubMed10.1111/j.1365-2443.2004.00812.xPubMed10.1016/j.bbrc.2006.08.049PubMed10.1021/bi100042bHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:14106UniProt, Q9HCU8виправивши або дописавши їїпідказкою

Multi tool use
Multi tool use

Гени на хромосомі 11Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінПролінГлутамінАргінінСеринТреонінВалінТриптофанрепарація ДНКреплікація ДНКальтернативний сплайсингядрі


































POLD4
Ідентифікатори

Символи

POLD4, POLDS, p12, polymerase (DNA) delta 4, accessory subunit, DNA polymerase delta 4, accessory subunit
Зовнішні ІД
MGI: 1916995 HomoloGene: 10909 GeneCards: POLD4








Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001256870
NM_021173



NM_027196
RefSeq (білок)

NP_001243799
NP_066996


NP_081472
Локус (UCSC)
Хр. 11: 67.35 – 67.36 Mb

н/д

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

POLD4 (англ. DNA polymerase delta 4, accessory subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 107 амінокислот, а молекулярна маса — 12 433[4].



Послідовність амінокислот





























1020304050
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLR
QFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCS
LWHLYPL

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК, реплікація ДНК, альтернативний сплайсинг.
Локалізований у ядрі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Liu L., Mo J.-Y., Rodriguez-Belmonte E.M., Lee M.Y.W.T. (2000). Identification of a fourth subunit of mammalian DNA polymerase delta.. J. Biol. Chem. 275: 18739 — 18744.  PubMed DOI:10.1074/jbc.M001217200


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Liu L., Rodriguez-Belmonte E.M., Mazloum N., Xie B., Lee M.Y.W.T. (2003). Identification of a novel protein, PDIP38, that interacts with the p50 subunit of DNA polymerase delta and proliferating cell nuclear antigen.. J. Biol. Chem. 278: 10041 — 10047.  PubMed DOI:10.1074/jbc.M208694200


  • Tsurimoto T., Shinozaki A., Yano M., Seki M., Enomoto T. (2005). Human Werner helicase interacting protein 1 (WRNIP1) functions as a novel modulator for DNA polymerase delta.. Genes Cells 10: 13 — 22.  PubMed DOI:10.1111/j.1365-2443.2004.00812.x


  • Liu G., Warbrick E. (2006). The p66 and p12 subunits of DNA polymerase delta are modified by ubiquitin and ubiquitin-like proteins.. Biochem. Biophys. Res. Commun. 349: 360 — 366.  PubMed DOI:10.1016/j.bbrc.2006.08.049


  • Meng X., Zhou Y., Lee E.Y., Lee M.Y., Frick D.N. (2010). The p12 subunit of human polymerase delta modulates the rate and fidelity of DNA synthesis.. Biochemistry 49: 3545 — 3554.  PubMed DOI:10.1021/bi100042b



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:14106 (англ.). Процитовано 8 вересня 2017. 


  4. UniProt, Q9HCU8 (англ.). Процитовано 8 вересня 2017. 



Див. також |


  • Хромосома 11





EZrrk,WE3AoDPtz1,bi8 c0t xJW,VL3 TEW xvC2PnitrxyNXIHKyTJj4ChggsdaJ0LJwZDrQd6vNeeGj9XkYj4kaMdJCB ovtoi9Is
A5QfT9kenI

Popular posts from this blog

No such entity with customerId The Next CEO of Stack OverflowTruncate table using resource model in Magento 2Custom Customer Attribute (string) get function not workingGetting current customer in custom REST API moduleSubstitute existing Customer EAV AttributesMagento 2 - Best practice for extending customer entityFatal error: Call to a member function create() on nullProduct custom attribute import with CSV Magento 2.2What is the distinction between defining a customer attribute as “system” versus not “user defined”?Custom EAV Entity Type Missing “default_attribute_set_id” In ModelMagento 2.2: Add Customer Attribute to Custom Tab in AdminHow to mass update custom dropdown customer attribute to all customers? PHP or SQL

Лель (журнал) Зміст Історія | Редакція | Автори і рубрики | Інтерв'ю, статті, рецензії | Див. також | Посилання | Навігаційне менюперевірена1 змінаСергій Чирков: «Плейбой» і «Пентхауз» у кіосках з'явилися вже після того, як зник «Лель»«Лель», підшивка 10 номерів (1992, 1993)Ніч з «Другом Читача»: казки на ніч для дорослихІнформація про журнал на сервері журналістів у ВР УкраїниНаталія Патрікєєва. Лель. Перший український еротичний журналр

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її