IKZF3 Література | Примітки | Див. також | Навігаційне менюIKZF313425428269IKZF3sequence-specific DNA bindingDNA bindingRNA polymerase II regulatory region sequence-specific DNA bindingprotein homodimerization activitytranscription factor activity, sequence-specific DNA bindingtranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific bindingзв'язування з іоном металуprotein bindingprotein heterodimerization activitynucleic acid bindingtranscription regulatory region DNA bindingidentical protein bindingRNA polymerase II transcription factor activity, sequence-specific DNA bindingЦитоплазмаЦитоплазматична мембранаклітинне ядроnucleoplasmГіалоплазмаregulation of apoptotic processregulation of transcription, DNA-templatedregulation of transcription from RNA polymerase II promotertranscription from RNA polymerase II promotertranscription, DNA-templatedB cell activationregulation of B cell proliferationregulation of lymphocyte differentiationmesoderm developmentregulation of B cell differentiationpositive regulation of transcription from RNA polymerase II promoterresponse to bacteriumAmigoQuickGOБільше даних2280622780ENSG00000161405ENSMUSG00000018168Q9UKT9O08900NM_183232NM_001257408NM_001257409NM_001257410NM_001257411NM_001257412NM_001257413NM_001257414NM_001284514NM_001284515NM_001284516NM_012481NM_183228NM_183229NM_183230NM_183231NM_011771NP_001244337NP_001244338NP_001244339NP_001244340NP_001244341NP_001244342NP_001244343NP_001271443NP_001271444NP_001271445NP_036613NP_899051NP_899052NP_899053NP_899054NP_899055NP_035901Хр. 17: 39.76 – 39.86 MbХр. 11: 98.46 – 98.55 MbPubMed10.1006/geno.1999.5949PubMed10.1101/gr.2596504PubMed10.1093/emboj/18.12.3419PubMed10.1074/jbc.M005457200PubMed10.4049/jimmunol.167.11.6366Захворювання, генетично пов'язані з IKZF3 переглянути/редагувати посилання на ВікіДанихHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:13178UniProt, Q9UKT9виправивши або дописавши їїпідказкою

Multi tool use
Multi tool use

Гени на хромосомі 17Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінфосфопротеїнівтранскрипціятранскрипціїальтернативний сплайсингцинкуДНКцитоплазміядрі






































IKZF3
Ідентифікатори

Символи

IKZF3, AIO, AIOLOS, ZNFN1A3, IKAROS family zinc finger 3
Зовнішні ІД
MGI: 1342542 HomoloGene: 8269 GeneCards: IKZF3

Пов'язані генетичні захворювання

primary biliary cirrhosis[1]








Шаблон експресії
PBB GE IKZF3 221092 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)


NM_011771
RefSeq (білок)

NP_035901
Локус (UCSC)
Хр. 17: 39.76 – 39.86 Mb

Хр. 11: 98.46 – 98.55 Mb

PubMed search

[2]
[3]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

IKZF3 (англ. IKAROS family zinc finger 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 509 амінокислот, а молекулярна маса — 58 023[5].



Послідовність амінокислот





































































































1020304050
MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANED
EDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIK
LERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQ
CGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEK
PYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGS
ERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE
MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHI
YQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMD
VYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIA
RGEHRALLK

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін


Y: Тирозин



Кодований геном білок за функцією належить до фосфопротеїнів.
Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг.
Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК.
Локалізований у цитоплазмі, ядрі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Hosokawa Y., Maeda Y., Takahashi E., Suzuki M., Seto M. (1999). Human aiolos, an ikaros-related zinc finger DNA binding protein: cDNA cloning, tissue expression pattern, and chromosomal mapping.. Genomics 61: 326 — 329.  PubMed DOI:10.1006/geno.1999.5949


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Romero F., Martinez-A C., Camonis J., Rebollo A. (1999). Aiolos transcription factor controls cell death in T cells by regulating Bcl-2 expression and its cellular localization.. EMBO J. 18: 3419 — 3430.  PubMed DOI:10.1093/emboj/18.12.3419


  • Perdomo J., Holmes M., Chong B., Crossley M. (2000). Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.. J. Biol. Chem. 275: 38347 — 38354.  PubMed DOI:10.1074/jbc.M005457200


  • Rebollo A., Ayllon V., Fleischer A., Martinez C.A., Zaballos A. (2001). The association of Aiolos transcription factor and Bcl-xL is involved in the control of apoptosis.. J. Immunol. 167: 6366 — 6373.  PubMed DOI:10.4049/jimmunol.167.11.6366



Примітки |




  1. Захворювання, генетично пов'язані з IKZF3 переглянути/редагувати посилання на ВікіДаних. 


  2. Human PubMed Reference:. 


  3. Mouse PubMed Reference:. 


  4. HUGO Gene Nomenclature Commitee, HGNC:13178 (англ.). Процитовано 12 вересня 2017. 


  5. UniProt, Q9UKT9 (англ.). Процитовано 12 вересня 2017. 



Див. також |


  • Хромосома 17





Lwvz5iJz4sYaL2oUdfwrSIuUezXT15r,BURHohoIjC
nw,nG0RVfQHZ96mjXeumx S,7if4ezUF,uOwuQ BLnfLrxsTiWW QJSqicNNE y2oj6WL4010J76a,oz5,hclu

Popular posts from this blog

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

No such entity with customerId The Next CEO of Stack OverflowTruncate table using resource model in Magento 2Custom Customer Attribute (string) get function not workingGetting current customer in custom REST API moduleSubstitute existing Customer EAV AttributesMagento 2 - Best practice for extending customer entityFatal error: Call to a member function create() on nullProduct custom attribute import with CSV Magento 2.2What is the distinction between defining a customer attribute as “system” versus not “user defined”?Custom EAV Entity Type Missing “default_attribute_set_id” In ModelMagento 2.2: Add Customer Attribute to Custom Tab in AdminHow to mass update custom dropdown customer attribute to all customers? PHP or SQL

Буцька Катерина Петрівна Зміст Біографія | Фільмографія | Дублювання та озвучення українською | Дублювання та озвучення російською | Озвучення реклами | Навігаційне менюперевірена109 змінвиправивши або дописавши її