OR4D10 Література | Примітки | Див. також | Навігаційне менюOR4D10303125882294OR4D10G-protein coupled receptor activityolfactory receptor activitytransmembrane signaling receptor activitysignal transducer activityintegral component of membraneЦитоплазматична мембранамембранаsensory perception of smelldetection of chemical stimulus involved in sensory perception of smelldetection of chemical stimulus involved in sensory perceptionСигнальна трансдукціяresponse to stimulusG-protein coupled receptor signaling pathwayAmigoQuickGO390197258676ENSG00000254466ENSMUSG00000067528Q8NGI6Q8VFV1NM_001004705NM_146681NP_001004705NP_666892Хр. 11: 59.47 – 59.48 MbХр. 19: 12.06 – 12.06 MbPubMed10.1101/gr.2596504PubMed10.1073/pnas.0307882100Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:15173UniProt, Q8NGI6виправивши або дописавши її

Гени на хромосомі 11Білкові рецепториНекатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанрецепторівg-білокспряжених рецепторівбілків внутрішньоклітинного сигналінгуклітинній мембрані


































OR4D10
Ідентифікатори

Символи

OR4D10, OR11-251, OR4D10P, OST711, olfactory receptor family 4 subfamily D member 10
Зовнішні ІД
MGI: 3031258 HomoloGene: 82294 GeneCards: OR4D10








Ортологи
ВидиЛюдинаМиша
Entrez

390197


258676
Ensembl

ENSG00000254466


ENSMUSG00000067528
UniProt

Q8NGI6


Q8VFV1
RefSeq (мРНК)

NM_001004705


NM_146681
RefSeq (білок)

NP_001004705

NP_666892
Локус (UCSC)
Хр. 11: 59.47 – 59.48 Mb

Хр. 19: 12.06 – 12.06 Mb

PubMed search
[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

OR4D10 (англ. Olfactory receptor family 4 subfamily D member 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 311 амінокислот, а молекулярна маса — 35 300[4].



Послідовність амінокислот




































































1020304050
MEMENCTRVKEFIFLGLTQNREVSLVLFLFLLLVYVTTLLGNLLIMVTVT
CESRLHTPMYFLLHNLSIADICFSSITVPKVLVDLLSERKTISFNHCFTQ
MFLFHLIGGVDVFSLSVMALDRYVAISKPLHYATIMSRDHCIGLTVAAWL
GGFVHSIVQISLLLPLPFCGPNVLDTFYCDVHRVLKLAHTDIFILELLMI
SNNGLLTTLWFFLLLVSYIVILSLPKSQAGEGRRKAISTCTSHITVVTLH
FVPCIYVYARPFTALPMDKAISVTFTVISPLLNPLIYTLRNHEMKSAMRR
LKRRLVPSDRK

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу.
Локалізований у клітинній мембрані, мембрані.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family.. Proc. Natl. Acad. Sci. U.S.A. 101: 2584 — 2589.  PubMed DOI:10.1073/pnas.0307882100


  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205 — 7205. 



Примітки |




  1. ↑ Human PubMed Reference:. 


  2. ↑ Mouse PubMed Reference:. 


  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:15173 (англ.). Процитовано 8 вересня 2017. 


  4. ↑ UniProt, Q8NGI6 (англ.). Процитовано 8 вересня 2017. 



Див. також |


  • Хромосома 11



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.

-

Popular posts from this blog

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

Image
iPad being using in wall mount battery swollen Should I cover my bicycle overnight while bikepacking? Do UK voters know if their MP will be the Speaker of the House? Why can't we play rap on piano? Plagiarism or not? Why didn't Miles's spider sense work before? How to tell a function to use the default argument values? Short story with a alien planet, government officials must wear exploding medallions If human space travel is limited by the G force vulnerability, is there a way to counter G forces? What about the virus in 12 Monkeys? Is it acceptable for a professor to tell male students to not think that they are smarter than female students? Avoiding the "not like other girls" trope? Apex Framework / library for consuming REST services Is there an expression that means doing something right before you will need it rather than doing it in case you might need it? Method Does Not Exist error message How to show a landlord what we have...
Read more

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Image
Автомобілі:ПозашляховикиАвтомобілі Nissan укр.автомобільNissanпозашляховиків195119601988двигун1951повнопривідникомамериканськийWillysарміїкузовомпікапиPerkins1987ЯпоніїІспанії2000дизельним ...
Read more

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?

Image
What to do when during a meeting client people start to fight (even physically) with each others? How to pass a string to a command that expects a file? How could our ancestors have domesticated a solitary predator? Solving "Resistance between two nodes on a grid" problem in Mathematica Why would one plane in this picture not have gear down yet? My story is written in English, but is set in my home country. What language should I use for the dialogue? Do items de-spawn in Diablo? Why doesn't this Google Translate ad use the word "Translation" instead of "Translate"? How do I express some one as a black person? Subset counting for even numbers Is there a window switcher for GNOME that shows the actual window? Are babies of evil humanoid species inherently evil? Could you please stop shuffling the deck and play already? Are the terms "stab" and "staccato" synonyms? What is the chance of making a successful ...
Read more