PRKG1 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB1ZXA3OCP3OD03OGJ4KU74KU84QX54QXK4R4L4R4M4Z07PRKG110817455964PRKG1transferase activitynucleotide bindingcalcium channel regulator activitycGMP bindingkinase activityprotein bindingcatalytic activityATP bindingprotein serine/threonine kinase activitycGMP-dependent protein kinase activityidentical protein bindingprotein kinase activityЦитоплазмаГіалоплазмаКомплекс ҐольджіЦитоплазматична мембранаnegative regulation of smooth muscle contractionфосфорилюванняregulation of GTPase activitydendrite developmentneuron migrationnegative regulation of platelet aggregationcGMP-mediated signalingrelaxation of vascular smooth muscleforebrain developmentОбмін речовинactin cytoskeleton organizationСигнальна трансдукціяprotein phosphorylationnegative regulation of vascular smooth muscle cell proliferationnegative regulation of vascular associated smooth muscle cell migrationAmigoQuickGOБільше даних559219091ENSG00000185532ENSMUSG00000052920Q13976P0C605NM_001098512NM_006258NM_001013833NM_011160NP_001091982NP_006249NP_001013855NP_035290Хр. 10: 50.99 – 52.3 MbХр. 19: 30.56 – 31.77 MbPubMed10.1006/geno.1997.4743PubMed10.1101/gr.2596504PubMed10.1074/jbc.M106562200PubMed10.1016/j.jmb.2007.08.049PubMed10.1124/pr.110.002907PubMed10.1016/j.cellsig.2011.03.005Захворювання, генетично пов'язані з PRKG1 переглянути/редагувати посилання на ВікіДанихHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:9414UniProt, Q13976виправивши або дописавши її

Гени на хромосомі 10ПротеїнкіназиНекатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофантрансферазкіназпротеїнкіназфосфопротеїнівальтернативний сплайсингАТФнуклеотидамицитоплазмі






































PRKG1
Protein PRKG1 PDB 1ZXA.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

PRKG1, AAT8, PKG, PRKG1B, PRKGR1B, cGK, cGK 1, cGK1, cGKI, cGKI-BETA, cGKI-alpha, protein kinase, cGMP-dependent, type I, PKG1, protein kinase cGMP-dependent 1
Зовнішні ІД
MGI: 108174 HomoloGene: 55964 GeneCards: PRKG1

Пов'язані генетичні захворювання

Ожиріння, бронхіальна астма[1]








Шаблон експресії

PBB GE PRKG1 207119 at fs.png

PBB GE PRKG1 211380 s at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez

5592


19091
Ensembl

ENSG00000185532


ENSMUSG00000052920
UniProt

Q13976


P0C605
RefSeq (мРНК)

NM_001098512
NM_006258


NM_001013833
NM_011160
RefSeq (білок)

NP_001091982
NP_006249

NP_001013855
NP_035290
Локус (UCSC)
Хр. 10: 50.99 – 52.3 Mb

Хр. 19: 30.56 – 31.77 Mb

PubMed search
[2]
[3]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

PRKG1 (англ. Protein kinase, cGMP-dependent, type I) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 671 амінокислот, а молекулярна маса — 76 364[5].



Послідовність амінокислот





































































































































1020304050
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVP
STHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILD
NDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEV
TKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTI
MMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIR
QGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAA
FFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDT
RQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTIL
RDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKL
VDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYE
LLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFD
SFPEDNDEPPPDDNSGWDIDF

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів.
Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг.
Білок має сайт для зв'язування з АТФ, нуклеотидами.
Локалізований у цитоплазмі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Orstavik S., Natarajan V., Tasken K., Jahnsen T., Sandberg M. (1997). Characterization of the human gene encoding the type I alpha and type I beta cGMP-dependent protein kinase (PRKG1).. Genomics 42: 311 — 318.  PubMed DOI:10.1006/geno.1997.4743


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Rybalkin S.D., Rybalkina I.G., Feil R., Hofmann F., Beavo J.A. (2002). Regulation of cGMP-specific phosphodiesterase (PDE5) phosphorylation in smooth muscle cells.. J. Biol. Chem. 277: 3310 — 3317.  PubMed DOI:10.1074/jbc.M106562200


  • Lee E., Hayes D.B., Langsetmo K., Sundberg E.J., Tao T.C. (2007). Interactions between the leucine-zipper motif of cGMP-dependent protein kinase and the C-terminal region of the targeting subunit of myosin light chain phosphatase.. J. Mol. Biol. 373: 1198 — 1212.  PubMed DOI:10.1016/j.jmb.2007.08.049


  • Francis S.H., Busch J.L., Corbin J.D., Sibley D. (2010). cGMP-dependent protein kinases and cGMP phosphodiesterases in nitric oxide and cGMP action.. Pharmacol. Rev. 62: 525 — 563.  PubMed DOI:10.1124/pr.110.002907


  • Yuasa K., Matsuda T., Tsuji A. (2011). Functional regulation of transient receptor potential canonical 7 by cGMP-dependent protein kinase Ialpha.. Cell. Signal. 23: 1179 — 1187.  PubMed DOI:10.1016/j.cellsig.2011.03.005



Примітки |




  1. ↑ Захворювання, генетично пов'язані з PRKG1 переглянути/редагувати посилання на ВікіДаних. 


  2. ↑ Human PubMed Reference:. 


  3. ↑ Mouse PubMed Reference:. 


  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:9414 (англ.). Процитовано 8 вересня 2017. 


  5. ↑ UniProt, Q13976 (англ.). Процитовано 8 вересня 2017. 



Див. також |


  • Хромосома 10



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.

-

Popular posts from this blog

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

Image
iPad being using in wall mount battery swollen Should I cover my bicycle overnight while bikepacking? Do UK voters know if their MP will be the Speaker of the House? Why can't we play rap on piano? Plagiarism or not? Why didn't Miles's spider sense work before? How to tell a function to use the default argument values? Short story with a alien planet, government officials must wear exploding medallions If human space travel is limited by the G force vulnerability, is there a way to counter G forces? What about the virus in 12 Monkeys? Is it acceptable for a professor to tell male students to not think that they are smarter than female students? Avoiding the "not like other girls" trope? Apex Framework / library for consuming REST services Is there an expression that means doing something right before you will need it rather than doing it in case you might need it? Method Does Not Exist error message How to show a landlord what we have...
Read more

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2

Image
Does the Pact of the Blade warlock feature allow me to customize the properties of the pact weapon I create? Why isn't everyone flabbergasted about Bran's "gift"? Paektu / Changbai border dispute — why does the BBC shade a large area around the mountain? Is it OK if I do not take the receipt in Germany? How to ask rejected full-time candidates to apply to teach individual courses? /bin/ls sorts differently than just ls What *exactly* is electrical current, voltage, and resistance? Coin Game with infinite paradox Diffie-Hellman with non-prime modulus Example of a central simple algebra Etymology of 見舞い Lights are flickering on and off after accidentally bumping into light switch A journey... into the MIND How to calculate density of unknown planet? How to produce a PS1 prompt in bash or ksh93 similar to tcsh What's the connection between Mr. Nancy and fried chicken? How can I delete rows in the text? How is it possible to imple...
Read more

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Image
Автомобілі:ПозашляховикиАвтомобілі Nissan укр.автомобільNissanпозашляховиків195119601988двигун1951повнопривідникомамериканськийWillysарміїкузовомпікапиPerkins1987ЯпоніїІспанії2000дизельним ...
Read more