BRI3 Література | Примітки | Див. також | Навігаційне менюBRI319331749114BRI3identical protein bindingмембранаintegral component of membraneЦитоплазматична мембранаazurophil granule membraneЛізосомаlysosomal membraneneutrophil degranulationAmigoQuickGO2579855950ENSG00000164713ENSMUSG00000047843O95415P28662NM_001159491NM_015379NM_001163709NM_018772NP_001152963NP_056194NP_001157181NP_061242Хр. 7: 98.25 – 98.31 MbХр. 5: 144.24 – 144.45 MbPubMed10.1101/gr.2596504Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:1109UniProt, O95415виправивши або дописавши їїпідказкою

Гени на хромосомі 7Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалін


































BRI3
Ідентифікатори

Символи

BRI3, I3, brain protein I3
Зовнішні ІД
MGI: 1933174 HomoloGene: 9114 GeneCards: BRI3








Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001159491
NM_015379



NM_001163709
NM_018772

RefSeq (білок)

NP_001152963
NP_056194


NP_001157181
NP_061242

Локус (UCSC)
Хр. 7: 98.25 – 98.31 Mb

Хр. 5: 144.24 – 144.45 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

BRI3 (англ. Brain protein I3) – білок, який кодується однойменним геном, розташованим у людей на 7-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 125 амінокислот, а молекулярна маса — 13 645[4].



Послідовність амінокислот


































1020304050
MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIP
THHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAII
LFPFGFICCFALRKRRCPNCGATFA

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін


Y: Тирозин



Локалізований у мембрані.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:1109 (англ.). Процитовано 19 вересня 2017. 


  4. UniProt, O95415 (англ.). Процитовано 19 вересня 2017. 



Див. також |


  • Хромосома 7





Popular posts from this blog

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?