ARRDC3 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB4N7H4R7V4R7XARRDC3214524269318ARRDC3protein bindingbeta-3 adrenergic receptor bindingЦитоплазмаЕндосомаЦитоплазматична мембранаЛізосомаearly endosomeмембранаfat pad developmentnegative regulation of heat generationtemperature homeostasispositive regulation of ubiquitin-protein transferase activitynegative regulation of locomotion involved in locomotory behaviorskin developmentСигнальна трансдукціяnegative regulation of adrenergic receptor signaling pathwaynegative regulation of cold-induced thermogenesisAmigoQuickGO57561105171ENSG00000113369ENSMUSG00000074794Q96B67Q7TPQ9NM_001329670NM_001329671NM_001329672NM_020801NM_001042591NP_001316599NP_001316600NP_001316601NP_065852NP_001036056Хр. 5: 91.37 – 91.38 MbХр. 13: 80.88 – 80.9 MbPubMed10.1093/dnares/7.1.65PubMed10.1101/gr.2596504PubMed10.1038/embor.2010.80PubMed10.1038/embor.2012.187PubMed10.1074/jbc.M113.527473PubMed10.1002/pro.2549Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:29263UniProt, Q96B67виправивши або дописавши їїпідказкою

Гени на хромосомі 5Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанклітинній мембраніцитоплазмілізосоміендосомах


































ARRDC3




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

ARRDC3, TLIMP, arrestin domain containing 3
Зовнішні ІД
MGI: 2145242 HomoloGene: 69318 GeneCards: ARRDC3








Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001329670
NM_001329671
NM_001329672
NM_020801



NM_001042591
RefSeq (білок)

NP_001316599
NP_001316600
NP_001316601
NP_065852


NP_001036056
Локус (UCSC)
Хр. 5: 91.37 – 91.38 Mb

Хр. 13: 80.88 – 80.9 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

ARRDC3 (англ. Arrestin domain containing 3) – білок, який кодується однойменним геном, розташованим у людей на 5-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 414 амінокислот, а молекулярна маса — 46 395[4].



Послідовність амінокислот






















































































1020304050
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIH
ARGHAKVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEE
GFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHRPWLLPV
KLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERK
GYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKMKEVKQLVANL
RGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYA
EVVTEEQRRNNLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPN
PDQSADDRPSCPSR

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Локалізований у клітинній мембрані, цитоплазмі, мембрані, лізосомі, ендосомах.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 65 — 73.  PubMed DOI:10.1093/dnares/7.1.65


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Nabhan J.F., Pan H., Lu Q. (2010). Arrestin domain-containing protein 3 recruits the NEDD4 E3 ligase to mediate ubiquitination of the beta2-adrenergic receptor.. EMBO Rep. 11: 605 — 611.  PubMed DOI:10.1038/embor.2010.80


  • Han S.O., Kommaddi R.P., Shenoy S.K. (2013). Distinct roles for beta-arrestin2 and arrestin-domain-containing proteins in beta2 adrenergic receptor trafficking.. EMBO Rep. 14: 164 — 171.  PubMed DOI:10.1038/embor.2012.187


  • Qi S., O'Hayre M., Gutkind J.S., Hurley J.H. (2014). Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3).. J. Biol. Chem. 289: 4743 — 4752.  PubMed DOI:10.1074/jbc.M113.527473


  • Qi S., O'Hayre M., Gutkind J.S., Hurley J.H. (2014). Insights into beta2-adrenergic receptor binding from structures of the N-terminal lobe of ARRDC3.. Protein Sci. 23: 1708 — 1716.  PubMed DOI:10.1002/pro.2549



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:29263 (англ.). Процитовано 18 вересня 2017. 


  4. UniProt, Q96B67 (англ.). Процитовано 18 вересня 2017. 



Див. також |


  • Хромосома 5





Popular posts from this blog

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?

Тонконіг бульбистий Зміст Опис | Поширення | Екологія | Господарське значення | Примітки | Див. також | Література | Джерела | Посилання | Навігаційне меню1114601320038-241116202404kew-435458Poa bulbosaЭлектронный каталог сосудистых растений Азиатской России [Електронний каталог судинних рослин Азіатської Росії]Малышев Л. Л. Дикие родичи культурных растений. Poa bulbosa L. - Мятлик луковичный. [Малишев Л. Л. Дикі родичи культурних рослин. Poa bulbosa L. - Тонконіг бульбистий.]Мятлик (POA) Сем. Злаки (Мятликовые) [Тонконіг (POA) Род. Злаки (Тонконогові)]Poa bulbosa Linnaeus, Sp. Pl. 1: 70. 1753. 鳞茎早熟禾 lin jing zao shu he (Description from Flora of China) [Poa bulbosa Linnaeus, Sp. Pl. 1: 70. 1753. 鳞茎早熟禾 lin jing zao shu he (Опис від Флора Китаю)]Poa bulbosa L. – lipnice cibulkatá / lipnica cibulkatáPoa bulbosa в базі даних Poa bulbosa на сайті Poa bulbosa в базі даних «Global Biodiversity Information Facility» (GBIF)Poa bulbosa в базі даних «Euro + Med PlantBase» — інформаційному ресурсі для Євро-середземноморського розмаїття рослинPoa bulbosa L. на сайті «Плантариум»

If a poisoned arrow's piercing damage is reduced to 0, do you still get poisoned? The 2019 Stack Overflow Developer Survey Results Are InDoes a zero-damage attack still count as a hit?Damage reduction and damage resistance: how to calculate?If a monk reduces damage to 0 using Deflect Missiles, does the attack still hit?Do damage resistance and temp hit points from False Life and the Heavy Armor Master feat stack?When does Armor of Agathys take effect?Should the damage from an unarmed strike be reduced by Heavy Armor Master?What's the duration of these wild feats?Does the Heavy Armor Master feat reduce damage twice against a mixed damage attack?Are Erinyes' Hellish Weapons poisonous in a PC's hands?How can I gain resistance to piercing, bludgeoning, and slashing damage while in heavy armor?Damage reduction and damage resistance: how to calculate?Can Mage Hand Legerdemain load a hand crossbow? What about two hand crossbows?Does the Polearm Master attack work with poison?