ARRDC3 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB4N7H4R7V4R7XARRDC3214524269318ARRDC3protein bindingbeta-3 adrenergic receptor bindingЦитоплазмаЕндосомаЦитоплазматична мембранаЛізосомаearly endosomeмембранаfat pad developmentnegative regulation of heat generationtemperature homeostasispositive regulation of ubiquitin-protein transferase activitynegative regulation of locomotion involved in locomotory behaviorskin developmentСигнальна трансдукціяnegative regulation of adrenergic receptor signaling pathwaynegative regulation of cold-induced thermogenesisAmigoQuickGO57561105171ENSG00000113369ENSMUSG00000074794Q96B67Q7TPQ9NM_001329670NM_001329671NM_001329672NM_020801NM_001042591NP_001316599NP_001316600NP_001316601NP_065852NP_001036056Хр. 5: 91.37 – 91.38 MbХр. 13: 80.88 – 80.9 MbPubMed10.1093/dnares/7.1.65PubMed10.1101/gr.2596504PubMed10.1038/embor.2010.80PubMed10.1038/embor.2012.187PubMed10.1074/jbc.M113.527473PubMed10.1002/pro.2549Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:29263UniProt, Q96B67виправивши або дописавши їїпідказкою

Multi tool use
Multi tool use

Гени на хромосомі 5Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанклітинній мембраніцитоплазмілізосоміендосомах


































ARRDC3




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

ARRDC3, TLIMP, arrestin domain containing 3
Зовнішні ІД
MGI: 2145242 HomoloGene: 69318 GeneCards: ARRDC3








Ортологи
ВидиЛюдинаМиша
Entrez

57561


105171
Ensembl

ENSG00000113369


ENSMUSG00000074794
UniProt

Q96B67


Q7TPQ9
RefSeq (мРНК)

NM_001329670
NM_001329671
NM_001329672
NM_020801


NM_001042591
RefSeq (білок)

NP_001316599
NP_001316600
NP_001316601
NP_065852

NP_001036056
Локус (UCSC)
Хр. 5: 91.37 – 91.38 Mb

Хр. 13: 80.88 – 80.9 Mb

PubMed search
[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

ARRDC3 (англ. Arrestin domain containing 3) – білок, який кодується однойменним геном, розташованим у людей на 5-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 414 амінокислот, а молекулярна маса — 46 395[4].



Послідовність амінокислот






















































































1020304050
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIH
ARGHAKVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEE
GFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHRPWLLPV
KLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERK
GYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKMKEVKQLVANL
RGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYA
EVVTEEQRRNNLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPN
PDQSADDRPSCPSR

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Локалізований у клітинній мембрані, цитоплазмі, мембрані, лізосомі, ендосомах.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 65 — 73.  PubMed DOI:10.1093/dnares/7.1.65


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Nabhan J.F., Pan H., Lu Q. (2010). Arrestin domain-containing protein 3 recruits the NEDD4 E3 ligase to mediate ubiquitination of the beta2-adrenergic receptor.. EMBO Rep. 11: 605 — 611.  PubMed DOI:10.1038/embor.2010.80


  • Han S.O., Kommaddi R.P., Shenoy S.K. (2013). Distinct roles for beta-arrestin2 and arrestin-domain-containing proteins in beta2 adrenergic receptor trafficking.. EMBO Rep. 14: 164 — 171.  PubMed DOI:10.1038/embor.2012.187


  • Qi S., O'Hayre M., Gutkind J.S., Hurley J.H. (2014). Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3).. J. Biol. Chem. 289: 4743 — 4752.  PubMed DOI:10.1074/jbc.M113.527473


  • Qi S., O'Hayre M., Gutkind J.S., Hurley J.H. (2014). Insights into beta2-adrenergic receptor binding from structures of the N-terminal lobe of ARRDC3.. Protein Sci. 23: 1708 — 1716.  PubMed DOI:10.1002/pro.2549



Примітки |




  1. ↑ Human PubMed Reference:. 


  2. ↑ Mouse PubMed Reference:. 


  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:29263 (англ.). Процитовано 18 вересня 2017. 


  4. ↑ UniProt, Q96B67 (англ.). Процитовано 18 вересня 2017. 



Див. також |


  • Хромосома 5



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.


Wiki letter w.svg

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка, скористайтеся підказкою та розставте посилання відповідно до прийнятих рекомендацій.


g,5iZpyv6sKcfml41zq
-
JsMjEuZtsJG26urWa,L6sgXRYF uGGU54x2dTRIANhmEyy7Ui9Dpila 1leI2e3iz5,u 0dyCSVEYXi4ZNrB6LwJ

Popular posts from this blog

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Image
Автомобілі:ПозашляховикиАвтомобілі Nissan укр.автомобільNissanпозашляховиків195119601988двигун1951повнопривідникомамериканськийWillysарміїкузовомпікапиPerkins1987ЯпоніїІспанії2000дизельним ...
Read more

No such entity with customerId The Next CEO of Stack OverflowTruncate table using resource model in Magento 2Custom Customer Attribute (string) get function not workingGetting current customer in custom REST API moduleSubstitute existing Customer EAV AttributesMagento 2 - Best practice for extending customer entityFatal error: Call to a member function create() on nullProduct custom attribute import with CSV Magento 2.2What is the distinction between defining a customer attribute as “system” versus not “user defined”?Custom EAV Entity Type Missing “default_attribute_set_id” In ModelMagento 2.2: Add Customer Attribute to Custom Tab in AdminHow to mass update custom dropdown customer attribute to all customers? PHP or SQL

Image
What is the difference between 'contrib' and 'non-free' packages repositories? How to find if SQL server backup is encrypted with TDE without restoring the backup Airship steam engine room - problems and conflict Gauss' Posthumous Publications? Direct Implications Between USA and UK in Event of No-Deal Brexit Why did early computer designers eschew integers? Small nick on power cord from an electric alarm clock, and copper wiring exposed but intact Which acid/base does a strong base/acid react when added to a buffer solution? Is a distribution that is normal, but highly skewed, considered Gaussian? What did the word "leisure" mean in late 18th Century usage? Calculate the Mean mean of two numbers Could you use a laser beam as a modulated carrier wave for radio signal? Why did the Drakh emissary look so blurred in S04:E11 "Lines of Communication"? How exploitable/balanced is this homebrew spell: Spell Permanency? How ca...
Read more

Буцька Катерина Петрівна Зміст Біографія | Фільмографія | Дублювання та озвучення українською | Дублювання та озвучення російською | Озвучення реклами | Навігаційне менюперевірена109 змінвиправивши або дописавши її

Image
Народились 2 квітняНародились 1988Українські акторкиУродженці КиєваУкраїнські акторки озвучування Київ Буцька Катерина Петрівна Народилася 2 квітня 1988 ( 1988-04-02 ) (31 рік) Київ Г...
Read more