ARRDC3 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB4N7H4R7V4R7XARRDC3214524269318ARRDC3protein bindingbeta-3 adrenergic receptor bindingЦитоплазмаЕндосомаЦитоплазматична мембранаЛізосомаearly endosomeмембранаfat pad developmentnegative regulation of heat generationtemperature homeostasispositive regulation of ubiquitin-protein transferase activitynegative regulation of locomotion involved in locomotory behaviorskin developmentСигнальна трансдукціяnegative regulation of adrenergic receptor signaling pathwaynegative regulation of cold-induced thermogenesisAmigoQuickGO57561105171ENSG00000113369ENSMUSG00000074794Q96B67Q7TPQ9NM_001329670NM_001329671NM_001329672NM_020801NM_001042591NP_001316599NP_001316600NP_001316601NP_065852NP_001036056Хр. 5: 91.37 – 91.38 MbХр. 13: 80.88 – 80.9 MbPubMed10.1093/dnares/7.1.65PubMed10.1101/gr.2596504PubMed10.1038/embor.2010.80PubMed10.1038/embor.2012.187PubMed10.1074/jbc.M113.527473PubMed10.1002/pro.2549Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:29263UniProt, Q96B67виправивши або дописавши їїпідказкою

Гени на хромосомі 5Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанклітинній мембраніцитоплазмілізосоміендосомах


































ARRDC3




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

ARRDC3, TLIMP, arrestin domain containing 3
Зовнішні ІД
MGI: 2145242 HomoloGene: 69318 GeneCards: ARRDC3








Ортологи
ВидиЛюдинаМиша
Entrez

57561


105171
Ensembl

ENSG00000113369


ENSMUSG00000074794
UniProt

Q96B67


Q7TPQ9
RefSeq (мРНК)

NM_001329670
NM_001329671
NM_001329672
NM_020801


NM_001042591
RefSeq (білок)

NP_001316599
NP_001316600
NP_001316601
NP_065852

NP_001036056
Локус (UCSC)
Хр. 5: 91.37 – 91.38 Mb

Хр. 13: 80.88 – 80.9 Mb

PubMed search
[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

ARRDC3 (англ. Arrestin domain containing 3) – білок, який кодується однойменним геном, розташованим у людей на 5-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 414 амінокислот, а молекулярна маса — 46 395[4].



Послідовність амінокислот






















































































1020304050
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIH
ARGHAKVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEE
GFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHRPWLLPV
KLKKEFTVFEHIDINTPSLLSPQAGTKEKTLCCWFCTSGPISLSAKIERK
GYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKMKEVKQLVANL
RGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYA
EVVTEEQRRNNLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPN
PDQSADDRPSCPSR

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Локалізований у клітинній мембрані, цитоплазмі, мембрані, лізосомі, ендосомах.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 65 — 73.  PubMed DOI:10.1093/dnares/7.1.65


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Nabhan J.F., Pan H., Lu Q. (2010). Arrestin domain-containing protein 3 recruits the NEDD4 E3 ligase to mediate ubiquitination of the beta2-adrenergic receptor.. EMBO Rep. 11: 605 — 611.  PubMed DOI:10.1038/embor.2010.80


  • Han S.O., Kommaddi R.P., Shenoy S.K. (2013). Distinct roles for beta-arrestin2 and arrestin-domain-containing proteins in beta2 adrenergic receptor trafficking.. EMBO Rep. 14: 164 — 171.  PubMed DOI:10.1038/embor.2012.187


  • Qi S., O'Hayre M., Gutkind J.S., Hurley J.H. (2014). Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3).. J. Biol. Chem. 289: 4743 — 4752.  PubMed DOI:10.1074/jbc.M113.527473


  • Qi S., O'Hayre M., Gutkind J.S., Hurley J.H. (2014). Insights into beta2-adrenergic receptor binding from structures of the N-terminal lobe of ARRDC3.. Protein Sci. 23: 1708 — 1716.  PubMed DOI:10.1002/pro.2549



Примітки |




  1. ↑ Human PubMed Reference:. 


  2. ↑ Mouse PubMed Reference:. 


  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:29263 (англ.). Процитовано 18 вересня 2017. 


  4. ↑ UniProt, Q96B67 (англ.). Процитовано 18 вересня 2017. 



Див. також |


  • Хромосома 5



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.


Wiki letter w.svg

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка, скористайтеся підказкою та розставте посилання відповідно до прийнятих рекомендацій.


-

Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Image
In the late 1940’s to early 1950’s what technology was available that could melt a LOT of ice? "One can do his homework in the library" Setting correct UTM zone Time travel short story where dinosaur doesn't taste like chicken Do Bugbears' arms literally get longer when it's their turn? Offered promotion but I'm leaving. Should I tell? Subset counting for even numbers The difference between 時　and 時は String reversal in Python Good allowance savings plan? Do f-stop and exposure time perfectly cancel? What are some noteworthy "mic-drop" moments in math? They call me Inspector Morse Do I really need to have a scientific explanation for my premise? Make a transparent 448*448 image Could a cubesat propel itself to Mars? What is the chance of making a successful appeal to dismissal decision from a PhD program after failing the qualifying exam in the 2nd attempt? Could a cubesat be propelled to the moon? the return of Stri
Read more

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

Image
iPad being using in wall mount battery swollen Should I cover my bicycle overnight while bikepacking? Do UK voters know if their MP will be the Speaker of the House? Why can't we play rap on piano? Plagiarism or not? Why didn't Miles's spider sense work before? How to tell a function to use the default argument values? Short story with a alien planet, government officials must wear exploding medallions If human space travel is limited by the G force vulnerability, is there a way to counter G forces? What about the virus in 12 Monkeys? Is it acceptable for a professor to tell male students to not think that they are smarter than female students? Avoiding the "not like other girls" trope? Apex Framework / library for consuming REST services Is there an expression that means doing something right before you will need it rather than doing it in case you might need it? Method Does Not Exist error message How to show a landlord what we have
Read more

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2

Image
Does the Pact of the Blade warlock feature allow me to customize the properties of the pact weapon I create? Why isn't everyone flabbergasted about Bran's "gift"? Paektu / Changbai border dispute — why does the BBC shade a large area around the mountain? Is it OK if I do not take the receipt in Germany? How to ask rejected full-time candidates to apply to teach individual courses? /bin/ls sorts differently than just ls What *exactly* is electrical current, voltage, and resistance? Coin Game with infinite paradox Diffie-Hellman with non-prime modulus Example of a central simple algebra Etymology of 見舞い Lights are flickering on and off after accidentally bumping into light switch A journey... into the MIND How to calculate density of unknown planet? How to produce a PS1 prompt in bash or ksh93 similar to tcsh What's the connection between Mr. Nancy and fried chicken? How can I delete rows in the text? How is it possible to implement
Read more