HEY2 Література | Примітки | Див. також | Навігаційне менюHEY2134188422705HEY2microsatellite bindingsequence-specific DNA bindingDNA bindingprotein dimerization activityprotein homodimerization activitytranscription factor activity, sequence-specific DNA bindingtranscription factor bindinghistone deacetylase bindingtranscription factor activity, RNA polymerase II core promoter sequence-specificRNA polymerase II activating transcription factor bindingprotein bindingprotein heterodimerization activitytranscription factor activity, transcription factor bindingRNA polymerase II transcription factor activity, sequence-specific DNA bindingRNA polymerase II regulatory region sequence-specific DNA bindingtranscriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific bindingtranscriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific bindingtranscription corepressor activitysequence-specific double-stranded DNA bindingtranscriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific bindingtranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific bindingЦитоплазмаtranscriptional repressor complexSin3 complexnucleoplasmклітинне ядроdorsal aorta morphogenesiscardiac vascular smooth muscle cell developmentcochlea developmentpattern specification processcell fate commitmentpulmonary valve morphogenesisregulation of auditory receptor cell differentiationnegative regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiationregulation of transcription, DNA-templatedheart trabecula formationtricuspid valve morphogenesisregulation of vasculogenesispulmonary artery morphogenesiscardiac septum morphogenesisnegative regulation of cardiac vascular smooth muscle cell differentiationmuscular septum morphogenesisventricular septum morphogenesisprotein-DNA complex assemblycardiac muscle hypertrophyoutflow tract morphogenesisascending aorta morphogenesiscardiac left ventricle morphogenesislabyrinthine layer blood vessel developmentnegative regulation of transcription from RNA polymerase II promotercoronary vasculature morphogenesissmooth muscle cell differentiationnegative regulation of gene expressionendocardial cushion to mesenchymal transition involved in heart valve formationtranscription, DNA-templatedventricular trabecula myocardium morphogenesispositive regulation of heart ratevasculogenesismulticellular organism developmentatrial septum morphogenesisnegative regulation of cardiac muscle cell apoptotic processheart developmentarterial endothelial cell differentiationpositive regulation of cardiac muscle cell proliferationblood vessel developmentcardiac muscle hypertrophy in response to stressumbilical cord morphogenesisnegative regulation of transcription regulatory region DNA bindingmesenchymal cell developmentartery developmentРегуляція експресії генівnegative regulation of transcription by transcription factor localizationnegative regulation of transcription initiation from RNA polymerase II promotervascular smooth muscle cell developmentanterior/posterior axis specificationtricuspid valve formationnegative regulation of transcription, DNA-templatedcardiac ventricle morphogenesiscardiac right ventricle morphogenesisventricular cardiac muscle cell developmentatrioventricular valve developmentpositive regulation of transcription from RNA polymerase II promoternegative regulation of Notch signaling pathwaycardiac epithelial to mesenchymal transitionNotch signaling involved in heart developmentNotch signaling pathwaypositive regulation of transcription, DNA-templatedДиференціація клітинregulation of neurogenesisaortic valve morphogenesisepithelial to mesenchymal transition involved in endocardial cushion formationpositive regulation of gene expressionnegative regulation of biomineral tissue developmentAmigoQuickGOБільше даних2349315214ENSG00000135547ENSMUSG00000019789Q9UBP5Q5TF93Q9QUS4NM_012259NM_013904NP_036391NP_038932Хр. 6: 125.75 – 125.76 MbХр. 10: 30.83 – 30.84 MbPubMed10.1016/S0925-4773(99)00080-5PubMed10.1126/science.287.5459.1820PubMed10.1101/gr.2596504PubMed10.1016/j.bbrc.2005.10.190PubMed10.1002/humu.9390Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:4881UniProt, Q9UBP5виправивши або дописавши їїпідказкою

Multi tool use
Multi tool use

Гени на хромосомі 6Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанрепресорівбілків розвиткутранскрипціятранскрипціїДНКядрі




































HEY2
Ідентифікатори

Символи

HEY2, CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, bHLHb32, hes related family bHLH transcription factor with YRPW motif 2
Зовнішні ІД
MGI: 1341884 HomoloGene: 22705 GeneCards: HEY2








Шаблон експресії
PBB GE HEY2 219743 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_012259


NM_013904
RefSeq (білок)

NP_036391

NP_038932
Локус (UCSC)
Хр. 6: 125.75 – 125.76 Mb

Хр. 10: 30.83 – 30.84 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

HEY2 (англ. Hes related family bHLH transcription factor with YRPW motif 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 337 амінокислот, а молекулярна маса — 35 808[4].



Послідовність амінокислот








































































1020304050
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARK
KRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
KMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLR
VRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN
GLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCV
PPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до репресорів, білків розвитку.
Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції.
Білок має сайт для зв'язування з ДНК.
Локалізований у ядрі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Leimeister C., Externbrinck A., Klamt B., Gessler M. (1999). Hey genes: a novel subfamily of hairy- and enhancer of split related genes specifically expressed during mouse embryogenesis.. Mech. Dev. 85: 173 — 177.  PubMed DOI:10.1016/S0925-4773(99)00080-5


  • Zhong T.P., Rosenberg M., Mohideen M.-A.P.K., Weinstein B., Fishman M.C. (2000). Gridlock, an HLH gene required for assembly of the aorta in zebrafish.. Science 287: 1820 — 1824.  PubMed DOI:10.1126/science.287.5459.1820


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Shirvani S., Xiang F., Koibuchi N., Chin M.T. (2006). CHF1/Hey2 suppresses SM-MHC promoter activity through an interaction with GATA-6.. Biochem. Biophys. Res. Commun. 339: 151 — 156.  PubMed DOI:10.1016/j.bbrc.2005.10.190


  • Reamon-Buettner S.M., Borlak J. (2006). HEY2 mutations in malformed hearts.. Hum. Mutat. 27: 118 — 118.  PubMed DOI:10.1002/humu.9390



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:4881 (англ.). Процитовано 6 вересня 2017. 


  4. UniProt, Q9UBP5 (англ.). Процитовано 6 вересня 2017. 



Див. також |


  • Хромосома 6





6EkmZuB,RmgUQ h,5
1CNCFEb,oKYiAi MKOb FbwwNRiQPs,FdiT ZUis z4FLI lvqAEgG33,EDVG,cph mBNQ,QImU

Popular posts from this blog

No such entity with customerId The Next CEO of Stack OverflowTruncate table using resource model in Magento 2Custom Customer Attribute (string) get function not workingGetting current customer in custom REST API moduleSubstitute existing Customer EAV AttributesMagento 2 - Best practice for extending customer entityFatal error: Call to a member function create() on nullProduct custom attribute import with CSV Magento 2.2What is the distinction between defining a customer attribute as “system” versus not “user defined”?Custom EAV Entity Type Missing “default_attribute_set_id” In ModelMagento 2.2: Add Customer Attribute to Custom Tab in AdminHow to mass update custom dropdown customer attribute to all customers? PHP or SQL

Лель (журнал) Зміст Історія | Редакція | Автори і рубрики | Інтерв'ю, статті, рецензії | Див. також | Посилання | Навігаційне менюперевірена1 змінаСергій Чирков: «Плейбой» і «Пентхауз» у кіосках з'явилися вже після того, як зник «Лель»«Лель», підшивка 10 номерів (1992, 1993)Ніч з «Другом Читача»: казки на ніч для дорослихІнформація про журнал на сервері журналістів у ВР УкраїниНаталія Патрікєєва. Лель. Перший український еротичний журналр

Буцька Катерина Петрівна Зміст Біографія | Фільмографія | Дублювання та озвучення українською | Дублювання та озвучення російською | Озвучення реклами | Навігаційне менюперевірена109 змінвиправивши або дописавши її