TEK Література | Примітки | Див. також | Навігаційне менюPDBeRCSB4K0V1FVR2GY52GY72OO82OSC2P4I2WQB3L8P4X3JTEK98664397TEKtransferase activityprotein kinase activitynucleotide bindingkinase activityprotein bindingtransmembrane receptor protein tyrosine kinase activityprotein tyrosine kinase activityATP bindingRas guanyl-nucleotide exchange factor activitysignaling receptor activitygrowth factor bindingtransmembrane signaling receptor activityЦитоплазмаintegral component of membraneмембранаcell-cell junctionfocal adhesionintegral component of plasma membranestress fiberextracellular regionМікроворсинкиcell surfacebasal plasma membraneМіжклітинні контактиbasolateral plasma membraneapical plasma membraneМікрофіламентиmembrane raftЦитоскелетЦентр організації мікротрубочокЦитоплазматична мембранаreceptor complexnegative regulation of endothelial cell apoptotic processpositive regulation of protein kinase B signalingpositive regulation of protein phosphorylationresponse to hypoxiapositive regulation of endothelial cell proliferationheart trabecula formationфосфорилюванняtransmembrane receptor protein tyrosine kinase signaling pathwayregulation of endothelial cell apoptotic processcell-cell signalingresponse to peptide hormonesprouting angiogenesisnegative regulation of apoptotic processendochondral ossificationpositive regulation of intracellular signal transductionresponse to organic substancepositive regulation of angiogenesisMAPK cascadepositive regulation of phosphatidylinositol 3-kinase activitypositive regulation of endothelial cell migrationresponse to estrogenheart developmentregulation of vascular permeabilityprotein phosphorylationprotein oligomerizationendothelial cell proliferationАнгіогенезTie signaling pathwaypositive regulation of ERK1 and ERK2 cascadenegative regulation of angiogenesisautophosphorylationpositive regulation of focal adhesion assemblyregulation of establishment or maintenance of cell polaritypositive regulation of phosphatidylinositol 3-kinase signalingpeptidyl-tyrosine phosphorylationsubstrate adhesion-dependent cell spreadingresponse to cAMPdefinitive hemopoiesispositive regulation of actin cytoskeleton reorganizationnegative regulation of inflammatory responseleukocyte migrationСигнальна трансдукціяglomerulus vasculature developmentnegative regulation of signal transductionДиференціація клітинAmigoQuickGOБільше даних701021687ENSG00000120156ENSMUSG00000006386Q02763Q02858NM_000459NM_001290077NM_001290078NM_001290549NM_001290551NM_013690NP_000450NP_001277006NP_001277007NP_001277478NP_001277480NP_038718Хр. 9: 27.11 – 27.23 MbХр. 4: 94.74 – 94.87 MbPubMed10.1101/gr.2596504PubMed10.1110/ps.04682504PubMed10.1021/bi010959ePubMed10.1161/01.RES.0000063422.38690.DCPubMed10.1042/BJ20091010PubMed10.1128/MCB.01472-08Сполуки, які фізично взаємодіють з TEK receptor tyrosine kinase переглянути/редагувати посилання на ВікіДанихHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:11724UniProt, Q02763виправивши або дописавши їїпідказкою

Гени на хромосомі 9ПротеїнкіназиНекатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофантрансферазкіназрецепторівтирозинових протеїнкіназфосфопротеїнівангіогенезальтернативний сплайсингАТФнуклеотидамиклітинній мембраніцитоплазміцитоскелеті






































TEK
Protein TEK PDB 1fvr.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

TEK, CD202B, TIE-2, TIE2, VMCM, VMCM1, TEK tyrosine kinase, TEK receptor tyrosine kinase, GLC3E
Зовнішні ІД
MGI: 98664 HomoloGene: 397 GeneCards: TEK

Реагує на сполуку

linifanib[1]








Шаблон експресії

PBB GE TEK 217711 at fs.png

PBB GE TEK 206702 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_000459
NM_001290077
NM_001290078



NM_001290549
NM_001290551
NM_013690

RefSeq (білок)

NP_000450
NP_001277006
NP_001277007


NP_001277478
NP_001277480
NP_038718

Локус (UCSC)
Хр. 9: 27.11 – 27.23 Mb

Хр. 4: 94.74 – 94.87 Mb

PubMed search

[2]
[3]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

TEK (англ. TEK receptor tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 124 амінокислот, а молекулярна маса — 125 830[5].



Послідовність амінокислот






















































































































































































































1020304050
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWR
PHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAY
FCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKE
EDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFT
SAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRT
CEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTP
KIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNH
TDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNA
PNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNE
IVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLN
LLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNI
THSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLK
GLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIA
ILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGT
LALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRM
DAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVAR
GMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRL
PVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERK
TYVNTTLYEKFTYAGIDCSAEEAA

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, тирозинових протеїнкіназ, фосфопротеїнів.
Задіяний у таких біологічних процесах, як ангіогенез, альтернативний сплайсинг.
Білок має сайт для зв'язування з АТФ, нуклеотидами.
Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах.
Також секретований назовні.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504


  • Murray B.W., Padrique E.S., Pinko C., McTigue M.A. (2001). Mechanistic effects of autophosphorylation on receptor tyrosine kinase catalysis: enzymatic characterization of Tie2 and phospho-Tie2.. Biochemistry 40: 10243 — 10253.  PubMed DOI:10.1021/bi010959e


  • Hughes D.P., Marron M.B., Brindle N.P. (2003). The antiinflammatory endothelial tyrosine kinase Tie2 interacts with a novel nuclear factor-kappaB inhibitor ABIN-2.. Circ. Res. 92: 630 — 636.  PubMed DOI:10.1161/01.RES.0000063422.38690.DC


  • Wehrle C., Van Slyke P., Dumont D.J. (2009). Angiopoietin-1-induced ubiquitylation of Tie2 by c-Cbl is required for internalization and degradation.. Biochem. J. 423: 375 — 380.  PubMed DOI:10.1042/BJ20091010


  • Yuan H.T., Khankin E.V., Karumanchi S.A., Parikh S.M. (2009). Angiopoietin 2 is a partial agonist/antagonist of Tie2 signaling in the endothelium.. Mol. Cell. Biol. 29: 2011 — 2022.  PubMed DOI:10.1128/MCB.01472-08



Примітки |




  1. Сполуки, які фізично взаємодіють з TEK receptor tyrosine kinase переглянути/редагувати посилання на ВікіДаних. 


  2. Human PubMed Reference:. 


  3. Mouse PubMed Reference:. 


  4. HUGO Gene Nomenclature Commitee, HGNC:11724 (англ.). Процитовано 7 вересня 2017. 


  5. UniProt, Q02763 (англ.). Процитовано 7 вересня 2017. 



Див. також |


  • Хромосома 9





Popular posts from this blog

Лель (журнал) Зміст Історія | Редакція | Автори і рубрики | Інтерв'ю, статті, рецензії | Див. також | Посилання | Навігаційне менюперевірена1 змінаСергій Чирков: «Плейбой» і «Пентхауз» у кіосках з'явилися вже після того, як зник «Лель»«Лель», підшивка 10 номерів (1992, 1993)Ніч з «Другом Читача»: казки на ніч для дорослихІнформація про журнал на сервері журналістів у ВР УкраїниНаталія Патрікєєва. Лель. Перший український еротичний журналр

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?

No such entity with customerId The Next CEO of Stack OverflowTruncate table using resource model in Magento 2Custom Customer Attribute (string) get function not workingGetting current customer in custom REST API moduleSubstitute existing Customer EAV AttributesMagento 2 - Best practice for extending customer entityFatal error: Call to a member function create() on nullProduct custom attribute import with CSV Magento 2.2What is the distinction between defining a customer attribute as “system” versus not “user defined”?Custom EAV Entity Type Missing “default_attribute_set_id” In ModelMagento 2.2: Add Customer Attribute to Custom Tab in AdminHow to mass update custom dropdown customer attribute to all customers? PHP or SQL