LCN2 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB1DFV1L6M1NGL1QQS1X711X891X8U3BY03CBC3CMP3DSZ3DTQ3FW43FW53HWD3HWE3HWF3HWG3I0A3K3L3PEC3PED3T1D3TF63TZS3U033U0D4GH74IAW4IAX4K194MVI4MVK4MVL4QAE4ZFX4ZHC4ZHD4ZHF4ZHG4ZHHLCN2967574064LCN2transporter activitysmall molecule bindingprotease bindingiron ion bindingprotein homodimerization activityenterobactin bindingextracellular exosomeextracellular spaceГіалоплазмаspecific granule lumenextracellular regioncytoplasmic vesiclecytoplasmic vesicle lumenimmune system processiron ion homeostasision transportinnate immune responsecellular iron ion homeostasisАпоптозresponse to oxidative stressresponse to virusresponse to bacteriumresponse to herbicideresponse to mycotoxinpositive regulation of gene expressionsiderophore transportantimicrobial humoral responsepositive regulation of cell projection organizationresponse to nutrient levelscellular response to nutrient levelsresponse to drugneutrophil degranulationprotein homotrimerizationcellular response to hydrogen peroxidecellular response to lipopolysaccharidecellular response to interleukin-1cellular response to tumor necrosis factorextrinsic apoptotic signaling pathway in absence of ligandтранспортcytokine-mediated signaling pathwaydefense response to bacteriumsequestering of iron ionpositive regulation of cold-induced thermogenesisAmigoQuickGOБільше даних393416819ENSG00000148346ENSMUSG00000026822P80188P11672NM_005564NM_008491NP_005555NP_032517Хр. 9: 128.15 – 128.15 MbХр. 2: 32.38 – 32.39 MbPubMed10.1006/bbrc.1994.2096PubMed10.1006/geno.1997.4896PubMed10.1101/gr.2596504PubMed10.1016/0014-5793(94)01303-IPubMed10.1016/0014-5793(92)81511-JPubMed10.1038/emboj.2009.35Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:6526UniProt, P80188виправивши або дописавши їїпідказкою

Multi tool use
Multi tool use

Гени на хромосомі 9Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанапоптозімунітетвроджений імунітетальтернативний сплайсингзаліза




































LCN2
Protein LCN2 PDB 1dfv.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

LCN2, 24p3, MSFI, NGAL, p25, lipocalin 2
Зовнішні ІД
MGI: 96757 HomoloGene: 4064 GeneCards: LCN2








Шаблон експресії
PBB GE LCN2 212531 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez

3934


16819
Ensembl

ENSG00000148346


ENSMUSG00000026822
UniProt

P80188


P11672
RefSeq (мРНК)

NM_005564


NM_008491
RefSeq (білок)

NP_005555

NP_032517
Локус (UCSC)
Хр. 9: 128.15 – 128.15 Mb

Хр. 2: 32.38 – 32.39 Mb

PubMed search
[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

LCN2 (англ. Lipocalin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 198 амінокислот, а молекулярна маса — 22 588[4].



Послідовність амінокислот















































1020304050
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGK
WYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWI
RTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNR
EYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Задіяний у таких біологічних процесах, як апоптоз, імунітет, вроджений імунітет, транспорт іонів, транспорт заліза, транспорт, альтернативний сплайсинг.
Білок має сайт для зв'язування з іоном заліза.
Секретований назовні.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Bundgaard J.R., Sengelov H., Borregaard N., Kjeldsen L. (1994). Molecular cloning and expression of a cDNA encoding NGAL: a lipocalin expressed in human neutrophils.. Biochem. Biophys. Res. Commun. 202: 1468 — 1475.  PubMed DOI:10.1006/bbrc.1994.2096


  • Cowland J.B., Borregaard N. (1997). Molecular characterization and pattern of tissue expression of the gene for neutrophil gelatinase-associated lipocalin from humans.. Genomics 45: 17 — 23.  PubMed DOI:10.1006/geno.1997.4896


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Bartsch S., Tschesche H. (1995). Cloning and expression of human neutrophil lipocalin cDNA derived from bone marrow and ovarian cancer cells.. FEBS Lett. 357: 255 — 259.  PubMed DOI:10.1016/0014-5793(94)01303-I


  • Triebel S., Blaeser J., Reinke H., Tschesche H. (1992). A 25 kDa alpha 2-microglobulin-related protein is a component of the 125 kDa form of human gelatinase.. FEBS Lett. 314: 386 — 388.  PubMed DOI:10.1016/0014-5793(92)81511-J


  • Sheng Z., Wang S.Z., Green M.R. (2009). Transcription and signalling pathways involved in BCR-ABL-mediated misregulation of 24p3 and 24p3R.. EMBO J. 28: 866 — 876.  PubMed DOI:10.1038/emboj.2009.35



Примітки |




  1. ↑ Human PubMed Reference:. 


  2. ↑ Mouse PubMed Reference:. 


  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:6526 (англ.). Процитовано 7 вересня 2017. 


  4. ↑ UniProt, P80188 (англ.). Процитовано 7 вересня 2017. 



Див. також |


  • Хромосома 9



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.


Wiki letter w.svg

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка, скористайтеся підказкою та розставте посилання відповідно до прийнятих рекомендацій.


CRv4qbHpU55mu SpXKhq0w1T,7fG
-
THbEjBvR4f1z,T2o F2hhmR60f0Wk4AVosjXS3ud,z0BKZ5r1f,ov5YNY R4WNicAOmU9nh3rvhU6Mai7hkyKea

Popular posts from this blog

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Image
Автомобілі:ПозашляховикиАвтомобілі Nissan укр.автомобільNissanпозашляховиків195119601988двигун1951повнопривідникомамериканськийWillysарміїкузовомпікапиPerkins1987ЯпоніїІспанії2000дизельним ...
Read more

No such entity with customerId The Next CEO of Stack OverflowTruncate table using resource model in Magento 2Custom Customer Attribute (string) get function not workingGetting current customer in custom REST API moduleSubstitute existing Customer EAV AttributesMagento 2 - Best practice for extending customer entityFatal error: Call to a member function create() on nullProduct custom attribute import with CSV Magento 2.2What is the distinction between defining a customer attribute as “system” versus not “user defined”?Custom EAV Entity Type Missing “default_attribute_set_id” In ModelMagento 2.2: Add Customer Attribute to Custom Tab in AdminHow to mass update custom dropdown customer attribute to all customers? PHP or SQL

Image
What is the difference between 'contrib' and 'non-free' packages repositories? How to find if SQL server backup is encrypted with TDE without restoring the backup Airship steam engine room - problems and conflict Gauss' Posthumous Publications? Direct Implications Between USA and UK in Event of No-Deal Brexit Why did early computer designers eschew integers? Small nick on power cord from an electric alarm clock, and copper wiring exposed but intact Which acid/base does a strong base/acid react when added to a buffer solution? Is a distribution that is normal, but highly skewed, considered Gaussian? What did the word "leisure" mean in late 18th Century usage? Calculate the Mean mean of two numbers Could you use a laser beam as a modulated carrier wave for radio signal? Why did the Drakh emissary look so blurred in S04:E11 "Lines of Communication"? How exploitable/balanced is this homebrew spell: Spell Permanency? How ca...
Read more

Буцька Катерина Петрівна Зміст Біографія | Фільмографія | Дублювання та озвучення українською | Дублювання та озвучення російською | Озвучення реклами | Навігаційне менюперевірена109 змінвиправивши або дописавши її

Image
Народились 2 квітняНародились 1988Українські акторкиУродженці КиєваУкраїнські акторки озвучування Київ Буцька Катерина Петрівна Народилася 2 квітня 1988 ( 1988-04-02 ) (31 рік) Київ Г...
Read more