LCN2 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB1DFV1L6M1NGL1QQS1X711X891X8U3BY03CBC3CMP3DSZ3DTQ3FW43FW53HWD3HWE3HWF3HWG3I0A3K3L3PEC3PED3T1D3TF63TZS3U033U0D4GH74IAW4IAX4K194MVI4MVK4MVL4QAE4ZFX4ZHC4ZHD4ZHF4ZHG4ZHHLCN2967574064LCN2transporter activitysmall molecule bindingprotease bindingiron ion bindingprotein homodimerization activityenterobactin bindingextracellular exosomeextracellular spaceГіалоплазмаspecific granule lumenextracellular regioncytoplasmic vesiclecytoplasmic vesicle lumenimmune system processiron ion homeostasision transportinnate immune responsecellular iron ion homeostasisАпоптозresponse to oxidative stressresponse to virusresponse to bacteriumresponse to herbicideresponse to mycotoxinpositive regulation of gene expressionsiderophore transportantimicrobial humoral responsepositive regulation of cell projection organizationresponse to nutrient levelscellular response to nutrient levelsresponse to drugneutrophil degranulationprotein homotrimerizationcellular response to hydrogen peroxidecellular response to lipopolysaccharidecellular response to interleukin-1cellular response to tumor necrosis factorextrinsic apoptotic signaling pathway in absence of ligandтранспортcytokine-mediated signaling pathwaydefense response to bacteriumsequestering of iron ionpositive regulation of cold-induced thermogenesisAmigoQuickGOБільше даних393416819ENSG00000148346ENSMUSG00000026822P80188P11672NM_005564NM_008491NP_005555NP_032517Хр. 9: 128.15 – 128.15 MbХр. 2: 32.38 – 32.39 MbPubMed10.1006/bbrc.1994.2096PubMed10.1006/geno.1997.4896PubMed10.1101/gr.2596504PubMed10.1016/0014-5793(94)01303-IPubMed10.1016/0014-5793(92)81511-JPubMed10.1038/emboj.2009.35Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:6526UniProt, P80188виправивши або дописавши їїпідказкою

Гени на хромосомі 9Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанапоптозімунітетвроджений імунітетальтернативний сплайсингзаліза




































LCN2
Protein LCN2 PDB 1dfv.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

LCN2, 24p3, MSFI, NGAL, p25, lipocalin 2
Зовнішні ІД
MGI: 96757 HomoloGene: 4064 GeneCards: LCN2








Шаблон експресії
PBB GE LCN2 212531 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez

3934


16819
Ensembl

ENSG00000148346


ENSMUSG00000026822
UniProt

P80188


P11672
RefSeq (мРНК)

NM_005564


NM_008491
RefSeq (білок)

NP_005555

NP_032517
Локус (UCSC)
Хр. 9: 128.15 – 128.15 Mb

Хр. 2: 32.38 – 32.39 Mb

PubMed search
[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

LCN2 (англ. Lipocalin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 198 амінокислот, а молекулярна маса — 22 588[4].



Послідовність амінокислот















































1020304050
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGK
WYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWI
RTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNR
EYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Задіяний у таких біологічних процесах, як апоптоз, імунітет, вроджений імунітет, транспорт іонів, транспорт заліза, транспорт, альтернативний сплайсинг.
Білок має сайт для зв'язування з іоном заліза.
Секретований назовні.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Bundgaard J.R., Sengelov H., Borregaard N., Kjeldsen L. (1994). Molecular cloning and expression of a cDNA encoding NGAL: a lipocalin expressed in human neutrophils.. Biochem. Biophys. Res. Commun. 202: 1468 — 1475.  PubMed DOI:10.1006/bbrc.1994.2096


  • Cowland J.B., Borregaard N. (1997). Molecular characterization and pattern of tissue expression of the gene for neutrophil gelatinase-associated lipocalin from humans.. Genomics 45: 17 — 23.  PubMed DOI:10.1006/geno.1997.4896


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Bartsch S., Tschesche H. (1995). Cloning and expression of human neutrophil lipocalin cDNA derived from bone marrow and ovarian cancer cells.. FEBS Lett. 357: 255 — 259.  PubMed DOI:10.1016/0014-5793(94)01303-I


  • Triebel S., Blaeser J., Reinke H., Tschesche H. (1992). A 25 kDa alpha 2-microglobulin-related protein is a component of the 125 kDa form of human gelatinase.. FEBS Lett. 314: 386 — 388.  PubMed DOI:10.1016/0014-5793(92)81511-J


  • Sheng Z., Wang S.Z., Green M.R. (2009). Transcription and signalling pathways involved in BCR-ABL-mediated misregulation of 24p3 and 24p3R.. EMBO J. 28: 866 — 876.  PubMed DOI:10.1038/emboj.2009.35



Примітки |




  1. ↑ Human PubMed Reference:. 


  2. ↑ Mouse PubMed Reference:. 


  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:6526 (англ.). Процитовано 7 вересня 2017. 


  4. ↑ UniProt, P80188 (англ.). Процитовано 7 вересня 2017. 



Див. також |


  • Хромосома 9



Молекула міоглобіну
Це незавершена стаття про білки.
Ви можете допомогти проекту, виправивши або дописавши її.


Wiki letter w.svg

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка, скористайтеся підказкою та розставте посилання відповідно до прийнятих рекомендацій.


-

Popular posts from this blog

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

Image
iPad being using in wall mount battery swollen Should I cover my bicycle overnight while bikepacking? Do UK voters know if their MP will be the Speaker of the House? Why can't we play rap on piano? Plagiarism or not? Why didn't Miles's spider sense work before? How to tell a function to use the default argument values? Short story with a alien planet, government officials must wear exploding medallions If human space travel is limited by the G force vulnerability, is there a way to counter G forces? What about the virus in 12 Monkeys? Is it acceptable for a professor to tell male students to not think that they are smarter than female students? Avoiding the "not like other girls" trope? Apex Framework / library for consuming REST services Is there an expression that means doing something right before you will need it rather than doing it in case you might need it? Method Does Not Exist error message How to show a landlord what we have...
Read more

Nissan Patrol Зміст Перше покоління — 4W60 (1951-1960) | Друге покоління — 60 series (1960-1980) | Третє покоління (1980–2002) | Четверте покоління — Y60 (1987–1998) | П'яте покоління — Y61 (1997–2013) | Шосте покоління — Y62 (2010- ) | Посилання | Зноски | Навігаційне менюОфіційний український сайтТест-драйв Nissan Patrol 2010 7-го поколінняNissan PatrolКак мы тестировали Nissan Patrol 2016рвиправивши або дописавши її

Image
Автомобілі:ПозашляховикиАвтомобілі Nissan укр.автомобільNissanпозашляховиків195119601988двигун1951повнопривідникомамериканськийWillysарміїкузовомпікапиPerkins1987ЯпоніїІспанії2000дизельним ...
Read more

Best approach to update all entries in a list that is paginated?Best way to add items to a paginated listChoose Your Country: Best Usability approachUpdate list when a user is viewing the list without annoying themWhen would the best day to update your webpage be?What should happen when I add a Row to a paginated, sorted listShould I adopt infinite scrolling or classical pagination?How to show user that page objects automatically updateWhat is the best location to locate the comments section in a list pageBest way to combine filtering and selecting items in a listWhen one of two inputs must be updated to satisfy a consistency criteria, which should you update (if at all)?

Image
What to do when during a meeting client people start to fight (even physically) with each others? How to pass a string to a command that expects a file? How could our ancestors have domesticated a solitary predator? Solving "Resistance between two nodes on a grid" problem in Mathematica Why would one plane in this picture not have gear down yet? My story is written in English, but is set in my home country. What language should I use for the dialogue? Do items de-spawn in Diablo? Why doesn't this Google Translate ad use the word "Translation" instead of "Translate"? How do I express some one as a black person? Subset counting for even numbers Is there a window switcher for GNOME that shows the actual window? Are babies of evil humanoid species inherently evil? Could you please stop shuffling the deck and play already? Are the terms "stab" and "staccato" synonyms? What is the chance of making a successful ...
Read more