FGF6 Література | Примітки | Див. також | Навігаційне менюFGF69552010870FGF6fibroblast growth factor receptor bindinggrowth factor activityprotein tyrosine kinase activityRas guanyl-nucleotide exchange factor activityphosphatidylinositol-4,5-bisphosphate 3-kinase activity1-phosphatidylinositol-3-kinase activityextracellular regionСарколемавнутрішньоклітиннийextracellular spaceДиференціація клітинcell-cell signalingMAPK cascademulticellular organism developmentfibroblast growth factor receptor signaling pathwayАнгіогенезpositive regulation of cell proliferationcell proliferationmyoblast differentiationpositive regulation of cell divisioncartilage condensationСигнальна трансдукціяphosphatidylinositol phosphorylationpeptidyl-tyrosine phosphorylationphosphatidylinositol-3-phosphate biosynthetic processregulation of receptor activitypositive regulation of protein kinase B signalingAmigoQuickGOБільше даних225114177ENSG00000111241ENSMUSG00000000183P10767P21658NM_020996NM_010204NP_066276NP_034334Хр. 12: 4.43 – 4.45 MbХр. 6: 127.02 – 127.03 MbPubMed10.1101/gr.2596504PubMed10.1038/nrc2780PubMedHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:3684UniProt, P10767виправивши або дописавши їїпідказкою

Гени на хромосомі 12Фактори росту


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанфакторів ростумітогенівбілків розвиткуангіогенездиференціація клітин




































FGF6
Ідентифікатори

Символи

FGF6, HBGF-6, HST2, fibroblast growth factor 6
Зовнішні ІД
MGI: 95520 HomoloGene: 10870 GeneCards: FGF6








Шаблон експресії
PBB GE FGF6 208417 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_020996


NM_010204
RefSeq (білок)

NP_066276

NP_034334
Локус (UCSC)
Хр. 12: 4.43 – 4.45 Mb

Хр. 6: 127.02 – 127.03 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

FGF6 (англ. Fibroblast growth factor 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 208 амінокислот, а молекулярна маса — 22 905[4].



Послідовність амінокислот















































1020304050
MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLD
SRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQV
LPDGRISGTHEENPYSLLEISTVERGVVSLFGVRSALFVAMNSKGRLYAT
PSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRVKRGSKVSPIMT
VTHFLPRI

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до факторів росту, мітогенів, білків розвитку.
Задіяний у таких біологічних процесах, як ангіогенез, диференціація клітин.
Секретований назовні.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Turner N., Grose R. (2010). Fibroblast growth factor signalling: from development to cancer.. Nat. Rev. Cancer 10: 116 — 129.  PubMed DOI:10.1038/nrc2780


  • Coulier F., Batoz M., Marics I., de Lapeyriere O., Birnbaum D. (1991). Putative structure of the FGF6 gene product and role of the signal peptide.. Oncogene 6: 1437 — 1444.  PubMed



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:3684 (англ.). Процитовано 11 вересня 2017. 


  4. UniProt, P10767 (англ.). Процитовано 11 вересня 2017. 



Див. також |


  • Хромосома 12





Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2