Глюкозозалежний інсулінотропний поліпептид Зміст Структура | Функції | Література | Примітки | Див. також | Навігаційне менюPDBeRCSB2L712B4N2OBU2QKH2L701T5QGIP1372401075043043GIPhormone activityprotein bindingreceptor bindingЦитоплазмаendoplasmic reticulum lumenextracellular regionneuronal cell bodysecretory granule lumenextracellular spaceresponse to selenium ionresponse to amino acidresponse to organic cyclic compounddigestive system developmentregulation of insulin secretionadult locomotory behaviorfemale pregnancyresponse to peptide hormonepositive regulation of cAMP-mediated signalingпам'ятьresponse to glucoseresponse to lipidresponse to nutrient levelspositive regulation of synaptic transmissionexploration behaviorresponse to axon injuryresponse to starvationnociceptionpositive regulation of glucagon secretionpositive regulation of glucose transportresponse to carbohydrateresponse to drugtriglyceride homeostasisСигнальна трансдукціяresponse to acidic pHendocrine pancreas developmentpositive regulation of insulin secretionlong-term synaptic potentiationregulation of receptor activityG-protein coupled receptor signaling pathwayregulation of fatty acid biosynthetic processAmigoQuickGO269514607ENSG00000159224ENSMUSG00000014351P09681P48756NM_004123NM_008119NP_004114NP_032145Хр. 17: 48.96 – 48.97 MbХр. 11: 96.02 – 96.03 MbPubMed10.1101/gr.2596504PubMed10.1016/0014-5793(84)81114-XHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:4270UniProt, P09681Можливості інкретинової терапії у лікуванні цукрового діабету 2-го типуЕндокринологія. 3 вид.: Підручник для ВМНЗ IV р.а.виправивши або дописавши її

Гени на хромосомі 17Пептидні гормони


англ.амінокислотмолекулярна масадванадцятипалоїсекретинуглюкагонуінкретиномсекреціїінсулінубета-клітинамиліпопротеїнліпазуАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофан


































Глюкозозалежний інсулінотропний поліпептид




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

GIP, gastric inhibitory polypeptide
Зовнішні ІД
OMIM: 137240 MGI: 107504 HomoloGene: 3043 GeneCards: GIP








Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_004123


NM_008119
RefSeq (білок)

NP_004114

NP_032145
Локус (UCSC)
Хр. 17: 48.96 – 48.97 Mb

Хр. 11: 96.02 – 96.03 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

Глюкозозалежний інсулінотропний поліпептид, також глюкозозалежний інсулінотропний пептид, глюкозозалежний інсулінотропний гормон, ГІП (англ. Gastric inhibitory polypeptide) – білок, який кодується геном GIP, розташованим у людей на довгому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 153 амінокислот, а молекулярна маса — 17 108[4]. Це пептидний гормон, що виробляється K-клітинами слизової оболонки дванадцятипалої та проксимальної частини тонкої кишки. Відноситься до родини секретину.[5][6]






Зміст





  • 1 Структура


  • 2 Функції


  • 3 Література


  • 4 Примітки


  • 5 Див. також




Структура |


Зрілий ГІП людини складається з 42 амінокислотних залишків: H-Tyr-Ala-Glu-Gly-Thr-Phe-lle-Ser-Asp-Tyr-Ser-lle-Ala-Met- Asp-Lys-lle-His-Gla-Glii-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala- GIn-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asii-lle-Thr-GiD-OH. Одна частина молекули ГІП збігається з молекулою секретину, інша — з молекулою глюкагону.



Функції |


Глюкозозалежний інсулінотропний поліпептид є інкретином. Стимуляторами секреції ГІП є жири і вуглеводи, які надходять в тонку кишку після перевареної в шлунку їжі. Подібно до інших гормонів, ГІП транспортується кровотоком.


Основна функція глюкозозалежного інсулінотропного поліпептиду — стимуляція секреції інсуліну бета-клітинами підшлункової залози у відповідь на прийом їжі. Крім того, ГІП пригнічує абсорбцію жирів, пригнічує реабсорбцію натрію і води в травному тракті, гальмує ліпопротеїнліпазу.



Послідовність амінокислот






































1020304050
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGP
RYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALE
LASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRL
RSR

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин




Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Moody A.J., Thim L., Valverde I. (1984). The isolation and sequencing of human gastric inhibitory peptide (GIP).. FEBS Lett. 172: 142 — 148.  PubMed DOI:10.1016/0014-5793(84)81114-X



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:4270 (англ.). Процитовано 5 жовтня 2018. 


  4. UniProt, P09681 (англ.). Процитовано 5 жовтня 2018. 


  5. Єрмолова Ю. В. (2013-06-20). Можливості інкретинової терапії у лікуванні цукрового діабету 2-го типу. Український медичний часопис. Процитовано 2016-06-20. 


  6. Боднар П. М. Ендокринологія. 3 вид.: Підручник для ВМНЗ IV р.а.. Нова Книга. ISBN 978-966-382-479-6. 



Див. також |


  • Хромосома 17



Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2