NKX2-1 Література | Примітки | Див. також | Навігаційне менюNKX2-11080672488NKX2-1DNA bindingsequence-specific DNA bindingintronic transcription regulatory region DNA bindingprotein bindingenzyme bindingRNA polymerase II regulatory region DNA bindingRNA polymerase II regulatory region sequence-specific DNA bindingcore promoter bindingintronic transcription regulatory region sequence-specific DNA bindingtranscription factor activity, sequence-specific DNA bindingtranscription factor activity, RNA polymerase II distal enhancer sequence-specific bindingtranscription regulatory region DNA bindingRNA polymerase II transcription factor activity, sequence-specific DNA bindingRNA polymerase II core promoter proximal region sequence-specific DNA bindingRNA polymerase II distal enhancer sequence-specific DNA bindingnucleoplasmклітинне ядроtranscription factor complexregulation of transcription, DNA-templatedритмічний процесnegative regulation of transforming growth factor beta receptor signaling pathwaytranscription, DNA-templatedpositive regulation of gene expressionnegative regulation of cell migrationresponse to hormoneforebrain developmentepithelial tube branching involved in lung morphogenesisnegative regulation of epithelial to mesenchymal transitionnegative regulation of transcription from RNA polymerase II promoterneuron migrationregulation of transcription from RNA polymerase II promoterphospholipid metabolic processpattern specification processaxon guidancebrain developmentendoderm developmentlocomotory behavioranimal organ morphogenesistelencephalon developmentglobus pallidus developmenthippocampus developmentcerebral cortex cell migrationforebrain dorsal/ventral pattern formationforebrain neuron fate commitmentforebrain neuron differentiationcerebral cortex GABAergic interneuron differentiationcerebral cortex neuron differentiationpituitary gland developmenttelencephalon cell migrationlung developmentthyroid gland developmentdevelopmental inductionLeydig cell differentiationpositive regulation of circadian rhythmnegative regulation of transcription, DNA-templatedpositive regulation of transcription, DNA-templatedpositive regulation of transcription from RNA polymerase II promoteranatomical structure formation involved in morphogenesisneuron fate commitmentoligodendrocyte differentiationlung saccule developmentClara cell differentiationType II pneumocyte differentiationДиференціація клітинAmigoQuickGOБільше даних708021869ENSG00000136352ENSMUSG00000001496P43699P50220NM_001079668NM_003317NM_001146198NM_009385NP_001073136NP_003308NP_001139670NP_033411Хр. 14: 36.52 – 36.52 MbХр. 12: 56.53 – 56.54 MbPubMed10.1016/0167-4781(95)00033-DPubMed10.1016/0167-4781(95)00034-EPubMed10.1101/gr.2596504PubMed10.1016/j.jpeds.2004.04.011PubMed10.1177/0883073813518243Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:11825UniProt, P43699виправивши або дописавши її

Гени на хромосомі 14Hox-гени


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанрепресорівактиваторівфосфопротеїнівтранскрипціятранскрипціїальтернативний сплайсингДНКядрі




































NKX2-1
Protein TITF1 PDB 1ftt.png
Ідентифікатори

Символи

NKX2-1, Nkx2-1, AV026640, Nkx2.1, T/EBP, Titf1, Ttf-1, BCH, BHC, NK-2, NKX2A, TEBP, TTF1, NMTC1, NK2 homeobox 1
Зовнішні ІД
MGI: 108067 HomoloGene: 2488 GeneCards: NKX2-1








Шаблон експресії

PBB GE TITF1 210673 x at fs.png

PBB GE TITF1 211024 s at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001079668
NM_003317



NM_001146198
NM_009385

RefSeq (білок)

NP_001073136
NP_003308


NP_001139670
NP_033411

Локус (UCSC)
Хр. 14: 36.52 – 36.52 Mb

Хр. 12: 56.53 – 56.54 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

NKX2-1 (англ. NK2 homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 371 амінокислот, а молекулярна маса — 38 596[4].



Послідовність амінокислот















































































1020304050
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPT
AAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY
QDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS
KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHL
TPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQA
QQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA
AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL
NSSGSDYGTMSCSTLLYGRTW

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів.
Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг.
Білок має сайт для зв'язування з ДНК.
Локалізований у ядрі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Oguchi H., Pan Y.-T., Kimura S. (1995). The complete nucleotide sequence of the mouse thyroid-specific enhancer-binding protein (T/EBP) gene: extensive identity of the deduced amino acid sequence with the human protein.. Biochim. Biophys. Acta 1261: 304 — 306.  PubMed DOI:10.1016/0167-4781(95)00033-D


  • Saiardi A., Tassi V., de Filippis V., Civitareale D. (1995). Cloning and sequence analysis of human thyroid transcription factor 1.. Biochim. Biophys. Acta 1261: 307 — 310.  PubMed DOI:10.1016/0167-4781(95)00034-E


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Doyle D.A., Gonzalez I., Thomas B., Scavina M. (2004). Autosomal dominant transmission of congenital hypothyroidism, neonatal respiratory distress, and ataxia caused by a mutation of NKX2-1.. J. Pediatr. 145: 190 — 193.  PubMed DOI:10.1016/j.jpeds.2004.04.011


  • Williamson S., Kirkpatrick M., Greene S., Goudie D. (2014). A novel mutation of NKX2-1 affecting 2 generations with hypothyroidism and choreoathetosis: part of the spectrum of brain-thyroid-lung syndrome.. J. Child Neurol. 29: 666 — 669.  PubMed DOI:10.1177/0883073813518243



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:11825 (англ.). Процитовано 11 вересня 2017. 


  4. UniProt, P43699 (англ.). Процитовано 11 вересня 2017. 



Див. також |


  • Хромосома 14



Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2