IKZF3 Література | Примітки | Див. також | Навігаційне менюIKZF313425428269IKZF3sequence-specific DNA bindingDNA bindingRNA polymerase II regulatory region sequence-specific DNA bindingprotein homodimerization activitytranscription factor activity, sequence-specific DNA bindingtranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific bindingзв'язування з іоном металуprotein bindingprotein heterodimerization activitynucleic acid bindingtranscription regulatory region DNA bindingidentical protein bindingRNA polymerase II transcription factor activity, sequence-specific DNA bindingЦитоплазмаЦитоплазматична мембранаклітинне ядроnucleoplasmГіалоплазмаregulation of apoptotic processregulation of transcription, DNA-templatedregulation of transcription from RNA polymerase II promotertranscription from RNA polymerase II promotertranscription, DNA-templatedB cell activationregulation of B cell proliferationregulation of lymphocyte differentiationmesoderm developmentregulation of B cell differentiationpositive regulation of transcription from RNA polymerase II promoterresponse to bacteriumAmigoQuickGOБільше даних2280622780ENSG00000161405ENSMUSG00000018168Q9UKT9O08900NM_183232NM_001257408NM_001257409NM_001257410NM_001257411NM_001257412NM_001257413NM_001257414NM_001284514NM_001284515NM_001284516NM_012481NM_183228NM_183229NM_183230NM_183231NM_011771NP_001244337NP_001244338NP_001244339NP_001244340NP_001244341NP_001244342NP_001244343NP_001271443NP_001271444NP_001271445NP_036613NP_899051NP_899052NP_899053NP_899054NP_899055NP_035901Хр. 17: 39.76 – 39.86 MbХр. 11: 98.46 – 98.55 MbPubMed10.1006/geno.1999.5949PubMed10.1101/gr.2596504PubMed10.1093/emboj/18.12.3419PubMed10.1074/jbc.M005457200PubMed10.4049/jimmunol.167.11.6366Захворювання, генетично пов'язані з IKZF3 переглянути/редагувати посилання на ВікіДанихHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:13178UniProt, Q9UKT9виправивши або дописавши їїпідказкою

Гени на хромосомі 17Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінфосфопротеїнівтранскрипціятранскрипціїальтернативний сплайсингцинкуДНКцитоплазміядрі






































IKZF3
Ідентифікатори

Символи

IKZF3, AIO, AIOLOS, ZNFN1A3, IKAROS family zinc finger 3
Зовнішні ІД
MGI: 1342542 HomoloGene: 8269 GeneCards: IKZF3

Пов'язані генетичні захворювання

primary biliary cirrhosis[1]








Шаблон експресії
PBB GE IKZF3 221092 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)


NM_011771
RefSeq (білок)

NP_035901
Локус (UCSC)
Хр. 17: 39.76 – 39.86 Mb

Хр. 11: 98.46 – 98.55 Mb

PubMed search

[2]
[3]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

IKZF3 (англ. IKAROS family zinc finger 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 509 амінокислот, а молекулярна маса — 58 023[5].



Послідовність амінокислот





































































































1020304050
MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANED
EDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIK
LERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQ
CGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEK
PYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGS
ERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE
MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHI
YQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMD
VYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIA
RGEHRALLK

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін


Y: Тирозин



Кодований геном білок за функцією належить до фосфопротеїнів.
Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг.
Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК.
Локалізований у цитоплазмі, ядрі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Hosokawa Y., Maeda Y., Takahashi E., Suzuki M., Seto M. (1999). Human aiolos, an ikaros-related zinc finger DNA binding protein: cDNA cloning, tissue expression pattern, and chromosomal mapping.. Genomics 61: 326 — 329.  PubMed DOI:10.1006/geno.1999.5949


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Romero F., Martinez-A C., Camonis J., Rebollo A. (1999). Aiolos transcription factor controls cell death in T cells by regulating Bcl-2 expression and its cellular localization.. EMBO J. 18: 3419 — 3430.  PubMed DOI:10.1093/emboj/18.12.3419


  • Perdomo J., Holmes M., Chong B., Crossley M. (2000). Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.. J. Biol. Chem. 275: 38347 — 38354.  PubMed DOI:10.1074/jbc.M005457200


  • Rebollo A., Ayllon V., Fleischer A., Martinez C.A., Zaballos A. (2001). The association of Aiolos transcription factor and Bcl-xL is involved in the control of apoptosis.. J. Immunol. 167: 6366 — 6373.  PubMed DOI:10.4049/jimmunol.167.11.6366



Примітки |




  1. Захворювання, генетично пов'язані з IKZF3 переглянути/редагувати посилання на ВікіДаних. 


  2. Human PubMed Reference:. 


  3. Mouse PubMed Reference:. 


  4. HUGO Gene Nomenclature Commitee, HGNC:13178 (англ.). Процитовано 12 вересня 2017. 


  5. UniProt, Q9UKT9 (англ.). Процитовано 12 вересня 2017. 



Див. також |


  • Хромосома 17





Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2