TEK Література | Примітки | Див. також | Навігаційне менюPDBeRCSB4K0V1FVR2GY52GY72OO82OSC2P4I2WQB3L8P4X3JTEK98664397TEKtransferase activityprotein kinase activitynucleotide bindingkinase activityprotein bindingtransmembrane receptor protein tyrosine kinase activityprotein tyrosine kinase activityATP bindingRas guanyl-nucleotide exchange factor activitysignaling receptor activitygrowth factor bindingtransmembrane signaling receptor activityЦитоплазмаintegral component of membraneмембранаcell-cell junctionfocal adhesionintegral component of plasma membranestress fiberextracellular regionМікроворсинкиcell surfacebasal plasma membraneМіжклітинні контактиbasolateral plasma membraneapical plasma membraneМікрофіламентиmembrane raftЦитоскелетЦентр організації мікротрубочокЦитоплазматична мембранаreceptor complexnegative regulation of endothelial cell apoptotic processpositive regulation of protein kinase B signalingpositive regulation of protein phosphorylationresponse to hypoxiapositive regulation of endothelial cell proliferationheart trabecula formationфосфорилюванняtransmembrane receptor protein tyrosine kinase signaling pathwayregulation of endothelial cell apoptotic processcell-cell signalingresponse to peptide hormonesprouting angiogenesisnegative regulation of apoptotic processendochondral ossificationpositive regulation of intracellular signal transductionresponse to organic substancepositive regulation of angiogenesisMAPK cascadepositive regulation of phosphatidylinositol 3-kinase activitypositive regulation of endothelial cell migrationresponse to estrogenheart developmentregulation of vascular permeabilityprotein phosphorylationprotein oligomerizationendothelial cell proliferationАнгіогенезTie signaling pathwaypositive regulation of ERK1 and ERK2 cascadenegative regulation of angiogenesisautophosphorylationpositive regulation of focal adhesion assemblyregulation of establishment or maintenance of cell polaritypositive regulation of phosphatidylinositol 3-kinase signalingpeptidyl-tyrosine phosphorylationsubstrate adhesion-dependent cell spreadingresponse to cAMPdefinitive hemopoiesispositive regulation of actin cytoskeleton reorganizationnegative regulation of inflammatory responseleukocyte migrationСигнальна трансдукціяglomerulus vasculature developmentnegative regulation of signal transductionДиференціація клітинAmigoQuickGOБільше даних701021687ENSG00000120156ENSMUSG00000006386Q02763Q02858NM_000459NM_001290077NM_001290078NM_001290549NM_001290551NM_013690NP_000450NP_001277006NP_001277007NP_001277478NP_001277480NP_038718Хр. 9: 27.11 – 27.23 MbХр. 4: 94.74 – 94.87 MbPubMed10.1101/gr.2596504PubMed10.1110/ps.04682504PubMed10.1021/bi010959ePubMed10.1161/01.RES.0000063422.38690.DCPubMed10.1042/BJ20091010PubMed10.1128/MCB.01472-08Сполуки, які фізично взаємодіють з TEK receptor tyrosine kinase переглянути/редагувати посилання на ВікіДанихHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:11724UniProt, Q02763виправивши або дописавши їїпідказкою

Гени на хромосомі 9ПротеїнкіназиНекатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофантрансферазкіназрецепторівтирозинових протеїнкіназфосфопротеїнівангіогенезальтернативний сплайсингАТФнуклеотидамиклітинній мембраніцитоплазміцитоскелеті






































TEK
Protein TEK PDB 1fvr.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

TEK, CD202B, TIE-2, TIE2, VMCM, VMCM1, TEK tyrosine kinase, TEK receptor tyrosine kinase, GLC3E
Зовнішні ІД
MGI: 98664 HomoloGene: 397 GeneCards: TEK

Реагує на сполуку

linifanib[1]








Шаблон експресії

PBB GE TEK 217711 at fs.png

PBB GE TEK 206702 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_000459
NM_001290077
NM_001290078



NM_001290549
NM_001290551
NM_013690

RefSeq (білок)

NP_000450
NP_001277006
NP_001277007


NP_001277478
NP_001277480
NP_038718

Локус (UCSC)
Хр. 9: 27.11 – 27.23 Mb

Хр. 4: 94.74 – 94.87 Mb

PubMed search

[2]
[3]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

TEK (англ. TEK receptor tyrosine kinase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 124 амінокислот, а молекулярна маса — 125 830[5].



Послідовність амінокислот






















































































































































































































1020304050
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWR
PHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAY
FCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKE
EDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFT
SAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRT
CEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTP
KIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNH
TDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNA
PNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNE
IVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLN
LLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNI
THSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLK
GLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIA
ILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGT
LALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRM
DAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVAR
GMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRL
PVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERK
TYVNTTLYEKFTYAGIDCSAEEAA

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до трансфераз, кіназ, рецепторів, тирозинових протеїнкіназ, фосфопротеїнів.
Задіяний у таких біологічних процесах, як ангіогенез, альтернативний сплайсинг.
Білок має сайт для зв'язування з АТФ, нуклеотидами.
Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах.
Також секретований назовні.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504


  • Murray B.W., Padrique E.S., Pinko C., McTigue M.A. (2001). Mechanistic effects of autophosphorylation on receptor tyrosine kinase catalysis: enzymatic characterization of Tie2 and phospho-Tie2.. Biochemistry 40: 10243 — 10253.  PubMed DOI:10.1021/bi010959e


  • Hughes D.P., Marron M.B., Brindle N.P. (2003). The antiinflammatory endothelial tyrosine kinase Tie2 interacts with a novel nuclear factor-kappaB inhibitor ABIN-2.. Circ. Res. 92: 630 — 636.  PubMed DOI:10.1161/01.RES.0000063422.38690.DC


  • Wehrle C., Van Slyke P., Dumont D.J. (2009). Angiopoietin-1-induced ubiquitylation of Tie2 by c-Cbl is required for internalization and degradation.. Biochem. J. 423: 375 — 380.  PubMed DOI:10.1042/BJ20091010


  • Yuan H.T., Khankin E.V., Karumanchi S.A., Parikh S.M. (2009). Angiopoietin 2 is a partial agonist/antagonist of Tie2 signaling in the endothelium.. Mol. Cell. Biol. 29: 2011 — 2022.  PubMed DOI:10.1128/MCB.01472-08



Примітки |




  1. Сполуки, які фізично взаємодіють з TEK receptor tyrosine kinase переглянути/редагувати посилання на ВікіДаних. 


  2. Human PubMed Reference:. 


  3. Mouse PubMed Reference:. 


  4. HUGO Gene Nomenclature Commitee, HGNC:11724 (англ.). Процитовано 7 вересня 2017. 


  5. UniProt, Q02763 (англ.). Процитовано 7 вересня 2017. 



Див. також |


  • Хромосома 9





Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2