LCN2 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB1DFV1L6M1NGL1QQS1X711X891X8U3BY03CBC3CMP3DSZ3DTQ3FW43FW53HWD3HWE3HWF3HWG3I0A3K3L3PEC3PED3T1D3TF63TZS3U033U0D4GH74IAW4IAX4K194MVI4MVK4MVL4QAE4ZFX4ZHC4ZHD4ZHF4ZHG4ZHHLCN2967574064LCN2transporter activitysmall molecule bindingprotease bindingiron ion bindingprotein homodimerization activityenterobactin bindingextracellular exosomeextracellular spaceГіалоплазмаspecific granule lumenextracellular regioncytoplasmic vesiclecytoplasmic vesicle lumenimmune system processiron ion homeostasision transportinnate immune responsecellular iron ion homeostasisАпоптозresponse to oxidative stressresponse to virusresponse to bacteriumresponse to herbicideresponse to mycotoxinpositive regulation of gene expressionsiderophore transportantimicrobial humoral responsepositive regulation of cell projection organizationresponse to nutrient levelscellular response to nutrient levelsresponse to drugneutrophil degranulationprotein homotrimerizationcellular response to hydrogen peroxidecellular response to lipopolysaccharidecellular response to interleukin-1cellular response to tumor necrosis factorextrinsic apoptotic signaling pathway in absence of ligandтранспортcytokine-mediated signaling pathwaydefense response to bacteriumsequestering of iron ionpositive regulation of cold-induced thermogenesisAmigoQuickGOБільше даних393416819ENSG00000148346ENSMUSG00000026822P80188P11672NM_005564NM_008491NP_005555NP_032517Хр. 9: 128.15 – 128.15 MbХр. 2: 32.38 – 32.39 MbPubMed10.1006/bbrc.1994.2096PubMed10.1006/geno.1997.4896PubMed10.1101/gr.2596504PubMed10.1016/0014-5793(94)01303-IPubMed10.1016/0014-5793(92)81511-JPubMed10.1038/emboj.2009.35Human PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:6526UniProt, P80188виправивши або дописавши їїпідказкою

Гени на хромосомі 9Некатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофанапоптозімунітетвроджений імунітетальтернативний сплайсингзаліза




































LCN2
Protein LCN2 PDB 1dfv.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

LCN2, 24p3, MSFI, NGAL, p25, lipocalin 2
Зовнішні ІД
MGI: 96757 HomoloGene: 4064 GeneCards: LCN2








Шаблон експресії
PBB GE LCN2 212531 at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_005564


NM_008491
RefSeq (білок)

NP_005555

NP_032517
Локус (UCSC)
Хр. 9: 128.15 – 128.15 Mb

Хр. 2: 32.38 – 32.39 Mb

PubMed search

[1]
[2]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

LCN2 (англ. Lipocalin 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 198 амінокислот, а молекулярна маса — 22 588[4].



Послідовність амінокислот















































1020304050
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGK
WYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWI
RTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNR
EYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Задіяний у таких біологічних процесах, як апоптоз, імунітет, вроджений імунітет, транспорт іонів, транспорт заліза, транспорт, альтернативний сплайсинг.
Білок має сайт для зв'язування з іоном заліза.
Секретований назовні.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Bundgaard J.R., Sengelov H., Borregaard N., Kjeldsen L. (1994). Molecular cloning and expression of a cDNA encoding NGAL: a lipocalin expressed in human neutrophils.. Biochem. Biophys. Res. Commun. 202: 1468 — 1475.  PubMed DOI:10.1006/bbrc.1994.2096


  • Cowland J.B., Borregaard N. (1997). Molecular characterization and pattern of tissue expression of the gene for neutrophil gelatinase-associated lipocalin from humans.. Genomics 45: 17 — 23.  PubMed DOI:10.1006/geno.1997.4896


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Bartsch S., Tschesche H. (1995). Cloning and expression of human neutrophil lipocalin cDNA derived from bone marrow and ovarian cancer cells.. FEBS Lett. 357: 255 — 259.  PubMed DOI:10.1016/0014-5793(94)01303-I


  • Triebel S., Blaeser J., Reinke H., Tschesche H. (1992). A 25 kDa alpha 2-microglobulin-related protein is a component of the 125 kDa form of human gelatinase.. FEBS Lett. 314: 386 — 388.  PubMed DOI:10.1016/0014-5793(92)81511-J


  • Sheng Z., Wang S.Z., Green M.R. (2009). Transcription and signalling pathways involved in BCR-ABL-mediated misregulation of 24p3 and 24p3R.. EMBO J. 28: 866 — 876.  PubMed DOI:10.1038/emboj.2009.35



Примітки |




  1. Human PubMed Reference:. 


  2. Mouse PubMed Reference:. 


  3. HUGO Gene Nomenclature Commitee, HGNC:6526 (англ.). Процитовано 7 вересня 2017. 


  4. UniProt, P80188 (англ.). Процитовано 7 вересня 2017. 



Див. також |


  • Хромосома 9





Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2