PRKG1 Література | Примітки | Див. також | Навігаційне менюPDBeRCSB1ZXA3OCP3OD03OGJ4KU74KU84QX54QXK4R4L4R4M4Z07PRKG110817455964PRKG1transferase activitynucleotide bindingcalcium channel regulator activitycGMP bindingkinase activityprotein bindingcatalytic activityATP bindingprotein serine/threonine kinase activitycGMP-dependent protein kinase activityidentical protein bindingprotein kinase activityЦитоплазмаГіалоплазмаКомплекс ҐольджіЦитоплазматична мембранаnegative regulation of smooth muscle contractionфосфорилюванняregulation of GTPase activitydendrite developmentneuron migrationnegative regulation of platelet aggregationcGMP-mediated signalingrelaxation of vascular smooth muscleforebrain developmentОбмін речовинactin cytoskeleton organizationСигнальна трансдукціяprotein phosphorylationnegative regulation of vascular smooth muscle cell proliferationnegative regulation of vascular associated smooth muscle cell migrationAmigoQuickGOБільше даних559219091ENSG00000185532ENSMUSG00000052920Q13976P0C605NM_001098512NM_006258NM_001013833NM_011160NP_001091982NP_006249NP_001013855NP_035290Хр. 10: 50.99 – 52.3 MbХр. 19: 30.56 – 31.77 MbPubMed10.1006/geno.1997.4743PubMed10.1101/gr.2596504PubMed10.1074/jbc.M106562200PubMed10.1016/j.jmb.2007.08.049PubMed10.1124/pr.110.002907PubMed10.1016/j.cellsig.2011.03.005Захворювання, генетично пов'язані з PRKG1 переглянути/редагувати посилання на ВікіДанихHuman PubMed Reference:Mouse PubMed Reference:HUGO Gene Nomenclature Commitee, HGNC:9414UniProt, Q13976виправивши або дописавши її

Гени на хромосомі 10ПротеїнкіназиНекатегоризовані білки


англ.амінокислотмолекулярна масаАланінЦистеїнАспарагінова кислотаГлутамінова кислотаФенілаланінГліцинГістидинІзолейцинЛізинЛейцинМетіонінАспарагінПролінГлутамінАргінінСеринТреонінВалінТриптофантрансферазкіназпротеїнкіназфосфопротеїнівальтернативний сплайсингАТФнуклеотидамицитоплазмі






































PRKG1
Protein PRKG1 PDB 1ZXA.png




Наявні структури
PDBПошук ортологів: PDBe RCSB

Ідентифікатори

Символи

PRKG1, AAT8, PKG, PRKG1B, PRKGR1B, cGK, cGK 1, cGK1, cGKI, cGKI-BETA, cGKI-alpha, protein kinase, cGMP-dependent, type I, PKG1, protein kinase cGMP-dependent 1
Зовнішні ІД
MGI: 108174 HomoloGene: 55964 GeneCards: PRKG1

Пов'язані генетичні захворювання

Ожиріння, бронхіальна астма[1]








Шаблон експресії

PBB GE PRKG1 207119 at fs.png

PBB GE PRKG1 211380 s at fs.png

Більше даних
Ортологи
ВидиЛюдинаМиша
Entrez
Ensembl

UniProt

RefSeq (мРНК)

NM_001098512
NM_006258



NM_001013833
NM_011160

RefSeq (білок)

NP_001091982
NP_006249


NP_001013855
NP_035290

Локус (UCSC)
Хр. 10: 50.99 – 52.3 Mb

Хр. 19: 30.56 – 31.77 Mb

PubMed search

[2]
[3]
Вікідані


Див./Ред. для людейДив./Ред. для мишей

PRKG1 (англ. Protein kinase, cGMP-dependent, type I) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 671 амінокислот, а молекулярна маса — 76 364[5].



Послідовність амінокислот





































































































































1020304050
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVP
STHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILD
NDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEV
TKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTI
MMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIR
QGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAA
FFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDT
RQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTIL
RDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKL
VDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYE
LLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFD
SFPEDNDEPPPDDNSGWDIDF

A: Аланін

C: Цистеїн

D: Аспарагінова кислота

E: Глутамінова кислота

F: Фенілаланін

G: Гліцин

H: Гістидин

I: Ізолейцин

K: Лізин

L: Лейцин

M: Метіонін

N: Аспарагін

P: Пролін

Q: Глутамін

R: Аргінін

S: Серин

T: Треонін

V: Валін

W: Триптофан


Y: Тирозин



Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів.
Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг.
Білок має сайт для зв'язування з АТФ, нуклеотидами.
Локалізований у цитоплазмі.



Література |


.mw-parser-output .refbeginfont-size:90%;margin-bottom:0.5em.mw-parser-output .refbegin-hanging-indents>ullist-style-type:none;margin-left:0.mw-parser-output .refbegin-hanging-indents>ul>li,.mw-parser-output .refbegin-hanging-indents>dl>ddmargin-left:0;padding-left:3.2em;text-indent:-3.2em;list-style:none.mw-parser-output .refbegin-100font-size:100%


  • Orstavik S., Natarajan V., Tasken K., Jahnsen T., Sandberg M. (1997). Characterization of the human gene encoding the type I alpha and type I beta cGMP-dependent protein kinase (PRKG1).. Genomics 42: 311 — 318.  PubMed DOI:10.1006/geno.1997.4743


  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504


  • Rybalkin S.D., Rybalkina I.G., Feil R., Hofmann F., Beavo J.A. (2002). Regulation of cGMP-specific phosphodiesterase (PDE5) phosphorylation in smooth muscle cells.. J. Biol. Chem. 277: 3310 — 3317.  PubMed DOI:10.1074/jbc.M106562200


  • Lee E., Hayes D.B., Langsetmo K., Sundberg E.J., Tao T.C. (2007). Interactions between the leucine-zipper motif of cGMP-dependent protein kinase and the C-terminal region of the targeting subunit of myosin light chain phosphatase.. J. Mol. Biol. 373: 1198 — 1212.  PubMed DOI:10.1016/j.jmb.2007.08.049


  • Francis S.H., Busch J.L., Corbin J.D., Sibley D. (2010). cGMP-dependent protein kinases and cGMP phosphodiesterases in nitric oxide and cGMP action.. Pharmacol. Rev. 62: 525 — 563.  PubMed DOI:10.1124/pr.110.002907


  • Yuasa K., Matsuda T., Tsuji A. (2011). Functional regulation of transient receptor potential canonical 7 by cGMP-dependent protein kinase Ialpha.. Cell. Signal. 23: 1179 — 1187.  PubMed DOI:10.1016/j.cellsig.2011.03.005



Примітки |




  1. Захворювання, генетично пов'язані з PRKG1 переглянути/редагувати посилання на ВікіДаних. 


  2. Human PubMed Reference:. 


  3. Mouse PubMed Reference:. 


  4. HUGO Gene Nomenclature Commitee, HGNC:9414 (англ.). Процитовано 8 вересня 2017. 


  5. UniProt, Q13976 (англ.). Процитовано 8 вересня 2017. 



Див. також |


  • Хромосома 10



Popular posts from this blog

Magento 2 duplicate PHPSESSID cookie when using session_start() in custom php scriptMagento 2: User cant logged in into to account page, no error showing!Magento duplicate on subdomainGrabbing storeview from cookie (after using language selector)How do I run php custom script on magento2Magento 2: Include PHP script in headerSession lock after using Cm_RedisSessionscript php to update stockMagento set cookie popupMagento 2 session id cookie - where to find it?How to import Configurable product from csv with custom attributes using php scriptMagento 2 run custom PHP script

Can not update quote_id field of “quote_item” table magento 2Magento 2.1 - We can't remove the item. (Shopping Cart doesnt allow us to remove items before becomes empty)Add value for custom quote item attribute using REST apiREST API endpoint v1/carts/cartId/items always returns error messageCorrect way to save entries to databaseHow to remove all associated quote objects of a customer completelyMagento 2 - Save value from custom input field to quote_itemGet quote_item data using quote id and product id filter in Magento 2How to set additional data to quote_item table from controller in Magento 2?What is the purpose of additional_data column in quote_item table in magento2Set Custom Price to Quote item magento2 from controller

How to solve knockout JS error in Magento 2 Planned maintenance scheduled April 23, 2019 at 23:30 UTC (7:30pm US/Eastern) Announcing the arrival of Valued Associate #679: Cesar Manara Unicorn Meta Zoo #1: Why another podcast?(Magento2) knockout.js:3012 Uncaught ReferenceError: Unable to process bindingUnable to process binding Knockout.js magento 2Cannot read property `scopeLabel` of undefined on Product Detail PageCan't get Customer Data on frontend in Magento 2Magento2 Order Summary - unable to process bindingKO templates are not loading in Magento 2.1 applicationgetting knockout js error magento 2Product grid not load -— Unable to process binding Knockout.js magento 2Product form not loaded in magento2Uncaught ReferenceError: Unable to process binding “if: function()return (isShowLegend()) ” magento 2